BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d12r (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28972| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_2771| Best HMM Match : rve (HMM E-Value=0.00087) 29 2.7 SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_2998| Best HMM Match : SRP19 (HMM E-Value=5) 28 8.1 >SB_28972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -2 Query: 479 HVNCNSSHCRITAS*EIIKQS*NEKQNIPNREQLNL 372 HVNC S+H + TA+ I ++ NEK+ N+ +N+ Sbjct: 94 HVNCRSNHGKSTAT--IFREQENEKKRKYNQRVMNV 127 >SB_2771| Best HMM Match : rve (HMM E-Value=0.00087) Length = 809 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = +2 Query: 209 IGHSVAASCHSFSIFTLQ--NFFKTCMYTYSYTLT 307 IG++V+A C + ++ L+ + F C YT++YT T Sbjct: 451 IGYAVSACCDAAAVPALRLGDLFPYCAYTHAYTYT 485 >SB_52793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 202 KWAYWKFTIWSFVIGAASSIAVMLRMRVLNYRAKRRARQILSN 74 +W +W I FV+GA I L+ V +A +AR++ +N Sbjct: 232 RWVFWIAAIPGFVVGAL--IVFTLKEPVKGEQAPMQARKVFTN 272 >SB_2998| Best HMM Match : SRP19 (HMM E-Value=5) Length = 258 Score = 27.9 bits (59), Expect = 8.1 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = -3 Query: 370 WVYQPYKVISECHPCSDFEIRSKSIGVCIHTSFKEILKCENGETVTRSCDRVAYLEKWAY 191 ++ P+++I C C++ ++ S + T K I GET R D VA LEKWA Sbjct: 164 FLVNPFQII--CPICNEIKVLSNMNQIRALT--KHIRDAHYGETKGR--DLVARLEKWAK 217 Query: 190 WKFT 179 +T Sbjct: 218 NNYT 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,828,165 Number of Sequences: 59808 Number of extensions: 364756 Number of successful extensions: 730 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -