BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d12f (631 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68470.1 68414.m07822 exostosin family protein contains Pfam ... 28 5.9 At1g22610.1 68414.m02823 C2 domain-containing protein contains I... 27 7.8 >At1g68470.1 68414.m07822 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 455 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 374 IRSKSIGVCIHTSFKEILKCENG 442 IR + I C +S E+LKCENG Sbjct: 294 IRDELIKQCAESSHCELLKCENG 316 >At1g22610.1 68414.m02823 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1029 Score = 27.5 bits (58), Expect = 7.8 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 103 RKNIIINLFSSQYHLFSLKEHKSGFHTSVTTLTS 2 R+ ++ + YH+FSL+ K+ F ++ L+S Sbjct: 803 RREVVEYMLDVDYHMFSLRRSKANFSRIMSLLSS 836 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,506,499 Number of Sequences: 28952 Number of extensions: 241026 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -