BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d10r (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyce... 124 1e-29 SPAC57A7.08 |pzh1||serine/threonine protein phosphatase Pzh1|Sch... 25 6.8 >SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyces pombe|chr 2|||Manual Length = 83 Score = 124 bits (299), Expect = 1e-29 Identities = 53/74 (71%), Positives = 63/74 (85%) Frame = -1 Query: 623 LAIDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTI 444 LA+DLL+PS SE RKHKLK+LV P S+FMDVKCPGC+ ITTVFSHAQ VV+C C+++ Sbjct: 3 LAVDLLNPSHESEMRKHKLKQLVQGPRSFFMDVKCPGCFNITTVFSHAQTVVICGSCASV 62 Query: 443 LCQPTGGRARLTEG 402 LCQPTGG+ARL EG Sbjct: 63 LCQPTGGKARLMEG 76 >SPAC57A7.08 |pzh1||serine/threonine protein phosphatase Pzh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 515 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +2 Query: 323 YELKQDCARLCNSLLWVTQVSNFTASYLQLI*HGHQWVDKGSLS 454 Y +C R CN +W T ++ F + + G + G LS Sbjct: 318 YGFYDECKRRCNIKIWKTFINTFNCLPIASVVAGKIFCVHGGLS 361 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,347,788 Number of Sequences: 5004 Number of extensions: 42626 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -