BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d10r (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) 126 1e-29 At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) iden... 122 3e-28 At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) 117 6e-27 At2g44870.1 68415.m05586 expressed protein 30 1.1 >At5g47930.1 68418.m05921 40S ribosomal protein S27 (RPS27D) Length = 84 Score = 126 bits (304), Expect = 1e-29 Identities = 54/72 (75%), Positives = 60/72 (83%) Frame = -1 Query: 617 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 438 IDLLHP P E+RKHKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC C T+LC Sbjct: 7 IDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLC 66 Query: 437 QPTGGRARLTEG 402 QPTGG+ARL EG Sbjct: 67 QPTGGKARLQEG 78 >At3g61110.1 68416.m06839 40S ribosomal protein S27 (ARS27A) identical to cDNA ribosomal protein S27 (ARS27A) GI:4193381 Length = 86 Score = 122 bits (293), Expect = 3e-28 Identities = 53/72 (73%), Positives = 60/72 (83%) Frame = -1 Query: 617 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 438 IDLL+P E+RKHKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VVVC C TILC Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTILC 66 Query: 437 QPTGGRARLTEG 402 QPTGG+A+LTEG Sbjct: 67 QPTGGKAKLTEG 78 >At2g45710.1 68415.m05685 40S ribosomal protein S27 (RPS27A) Length = 84 Score = 117 bits (282), Expect = 6e-27 Identities = 50/72 (69%), Positives = 59/72 (81%) Frame = -1 Query: 617 IDLLHPSPASERRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILC 438 IDLL+P E+RKHKLKRLV PNS+FMDVKC GC+ ITTVFSH+Q VV+C C T+LC Sbjct: 7 IDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVMCGNCQTLLC 66 Query: 437 QPTGGRARLTEG 402 PTGG+A+LTEG Sbjct: 67 TPTGGKAKLTEG 78 >At2g44870.1 68415.m05586 expressed protein Length = 248 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -1 Query: 545 NSYFMDVKCPGCYKITTVFSHAQRVVVCAGCSTILCQPTG 426 N++ + +CP C + + +++ C GC I+ QP G Sbjct: 175 NNFVIKGECPACKR--QFIGYKNQIIRCEGCGNIVWQPQG 212 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,076,202 Number of Sequences: 28952 Number of extensions: 216642 Number of successful extensions: 432 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -