BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d10f (601 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 26 1.1 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 4.3 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 128 SIN*ITVLSASSNKYG*TLKSTHGIKCQKQLINSHKYT 241 SI +T +SA ++KYG T K + I +++ ++YT Sbjct: 299 SIPGVTSISADTHKYGFTPKGSSVILYSEKVYRHYQYT 336 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 220 QLLLTFYAMCTFQCLTVFI*TCTQY 146 Q+ LTF A C + T F TCT + Sbjct: 170 QVYLTFPACCMYIPFTSFYATCTLF 194 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,352 Number of Sequences: 2352 Number of extensions: 10931 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -