BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12d06r (719 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC070378-1|AAH70378.1| 158|Homo sapiens basic transcription fac... 36 0.19 BC022371-1|AAH22371.1| 158|Homo sapiens BTF3L4 protein protein. 36 0.19 BC021004-1|AAH21004.1| 153|Homo sapiens BTF3L4 protein protein. 36 0.19 AL445685-6|CAI17032.1| 158|Homo sapiens basic transcription fac... 36 0.19 AL139156-5|CAI22856.1| 158|Homo sapiens basic transcription fac... 36 0.19 AK027750-1|BAB55342.1| 158|Homo sapiens protein ( Homo sapiens ... 36 0.19 X74070-1|CAA52200.1| 162|Homo sapiens transcription factor BTF3... 34 0.45 X53281-1|CAA37376.1| 162|Homo sapiens general transcription fac... 34 0.45 X53280-1|CAA37375.1| 206|Homo sapiens general transcription fac... 34 0.45 BT007120-1|AAP35784.1| 162|Homo sapiens basic transcription fac... 34 0.45 BC008062-1|AAH08062.1| 162|Homo sapiens basic transcription fac... 34 0.45 AB062126-1|BAB93458.1| 162|Homo sapiens transcription factor BT... 34 0.45 BC062736-1|AAH62736.1| 102|Homo sapiens LOC503543 protein protein. 32 2.4 AY392939-1|AAS85879.1| 141|Homo sapiens immunoglobulin heavy ch... 31 5.5 >BC070378-1|AAH70378.1| 158|Homo sapiens basic transcription factor 3-like 4 protein. Length = 158 Score = 35.5 bits (78), Expect = 0.19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 EEDD+VP+LV NFDEASK Sbjct: 137 EEDDDVPDLVENFDEASK 154 >BC022371-1|AAH22371.1| 158|Homo sapiens BTF3L4 protein protein. Length = 158 Score = 35.5 bits (78), Expect = 0.19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 EEDD+VP+LV NFDEASK Sbjct: 137 EEDDDVPDLVENFDEASK 154 >BC021004-1|AAH21004.1| 153|Homo sapiens BTF3L4 protein protein. Length = 153 Score = 35.5 bits (78), Expect = 0.19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 EEDD+VP+LV NFDEASK Sbjct: 132 EEDDDVPDLVENFDEASK 149 >AL445685-6|CAI17032.1| 158|Homo sapiens basic transcription factor 3-like 4 protein. Length = 158 Score = 35.5 bits (78), Expect = 0.19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 EEDD+VP+LV NFDEASK Sbjct: 137 EEDDDVPDLVENFDEASK 154 >AL139156-5|CAI22856.1| 158|Homo sapiens basic transcription factor 3-like 4 protein. Length = 158 Score = 35.5 bits (78), Expect = 0.19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 EEDD+VP+LV NFDEASK Sbjct: 137 EEDDDVPDLVENFDEASK 154 >AK027750-1|BAB55342.1| 158|Homo sapiens protein ( Homo sapiens cDNA FLJ14844 fis, clone PLACE1000133, highly similar to TRANSCRIPTION FACTOR BTF3. ). Length = 158 Score = 35.5 bits (78), Expect = 0.19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 EEDD+VP+LV NFDEASK Sbjct: 137 EEDDDVPDLVENFDEASK 154 >X74070-1|CAA52200.1| 162|Homo sapiens transcription factor BTF3 protein. Length = 162 Score = 34.3 bits (75), Expect = 0.45 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP+LV NFDEASK Sbjct: 141 DDDDEVPDLVENFDEASK 158 >X53281-1|CAA37376.1| 162|Homo sapiens general transcription factor protein. Length = 162 Score = 34.3 bits (75), Expect = 0.45 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP+LV NFDEASK Sbjct: 141 DDDDEVPDLVENFDEASK 158 >X53280-1|CAA37375.1| 206|Homo sapiens general transcription factor protein. Length = 206 Score = 34.3 bits (75), Expect = 0.45 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP+LV NFDEASK Sbjct: 185 DDDDEVPDLVENFDEASK 202 >BT007120-1|AAP35784.1| 162|Homo sapiens basic transcription factor 3 protein. Length = 162 Score = 34.3 bits (75), Expect = 0.45 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP+LV NFDEASK Sbjct: 141 DDDDEVPDLVENFDEASK 158 >BC008062-1|AAH08062.1| 162|Homo sapiens basic transcription factor 3 protein. Length = 162 Score = 34.3 bits (75), Expect = 0.45 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP+LV NFDEASK Sbjct: 141 DDDDEVPDLVENFDEASK 158 >AB062126-1|BAB93458.1| 162|Homo sapiens transcription factor BTF 3 protein. Length = 162 Score = 34.3 bits (75), Expect = 0.45 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP+LV NFDEASK Sbjct: 141 DDDDEVPDLVENFDEASK 158 >BC062736-1|AAH62736.1| 102|Homo sapiens LOC503543 protein protein. Length = 102 Score = 31.9 bits (69), Expect = 2.4 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 717 EEDDEVPNLVGNFDEASK 664 ++DDEVP ++ NFDEASK Sbjct: 81 DDDDEVPGIMENFDEASK 98 >AY392939-1|AAS85879.1| 141|Homo sapiens immunoglobulin heavy chain protein. Length = 141 Score = 30.7 bits (66), Expect = 5.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -3 Query: 534 MSRVSEAICVSKE*FSLLFHYVPGCMNFIMYCICLER 424 MSRV+ + SK FSL+ + V + YC+ L+R Sbjct: 73 MSRVTMPVDTSKNQFSLILNLVTAADTAVYYCVSLQR 109 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,610,785 Number of Sequences: 237096 Number of extensions: 1539069 Number of successful extensions: 4238 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 4184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4238 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8455186714 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -