BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c23f (575 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 25 0.71 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 0.71 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 24 0.94 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 1.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.2 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 1.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.6 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.9 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 3.8 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 5.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.7 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/66 (22%), Positives = 27/66 (40%) Frame = +2 Query: 260 VRFIWVRYGLVVVINPSLVTETSAVRLHPSDTIGLVSINRDVQPTDFISPVALSASEDLP 439 ++ I V + + +N + E ++LH I D Q D I+ V ++ P Sbjct: 1 MKTIVVIFAFCICVNAMTIEELK-IQLHDVQEICKTESGIDQQTVDDINEVNFDVEDEKP 59 Query: 440 ESGNVC 457 + N C Sbjct: 60 QRYNEC 65 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 0.71 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = +3 Query: 414 LCLPARTYPNPEMSAALAKSTANLESN*AASTC--PWC-PPTVSLRPPA 551 L L AR PN + +LA ++L S S C P P T PP+ Sbjct: 267 LLLKARLNPNSSLQPSLASHHSHLSSALGRSACHSPGVYPSTAGFLPPS 315 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 24.2 bits (50), Expect = 0.94 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 126 WLPSETSPTRSIYASLFR 179 W ++ P RSIY+SL R Sbjct: 370 WSSQKSEPRRSIYSSLLR 387 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 264 RTSWRQLAALRTQRE*MREPAQVLS 190 R +W++ + RT+RE REP + S Sbjct: 60 RETWKERSRDRTERERSREPKIISS 84 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 264 RTSWRQLAALRTQRE*MREPAQVLS 190 R +W++ + RT+RE REP + S Sbjct: 60 RETWKERSRDRTERERSREPKIISS 84 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 264 RTSWRQLAALRTQRE*MREPAQVLS 190 R +W++ + RT+RE REP + S Sbjct: 60 RETWKERSRDRTERERSREPKIISS 84 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 264 RTSWRQLAALRTQRE*MREPAQVLS 190 R +W++ + RT+RE REP + S Sbjct: 60 RETWKERSRDRTERERSREPKIISS 84 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 513 DTSKQLSCSPGSPSTSPKPQTFP 445 D+ + L+ S SPS SP+P P Sbjct: 870 DSQQPLNLSKKSPSPSPRPLVGP 892 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 226 ARVNEGTGAGVEQTTGRNSDA 164 AR EG GAG+ +T+ S++ Sbjct: 1236 AREREGVGAGIAETSAGTSNS 1256 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 2.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 336 VCTPRIPLVSSASTGMSNPLTS 401 VC+P + + +S + G PLT+ Sbjct: 35 VCSPDLSVFTSPACGSETPLTN 56 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 3.8 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -3 Query: 570 LEVWPSSLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGR 433 +EV P S + PS Q+SC SP P + +SGR Sbjct: 365 IEVIPLSAIPE--PSKNPAMGHWQMSCVACSPPPRQTPPSRKESGR 408 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +2 Query: 29 GLSRKMKVLSFVLLCGLALVQGRSTGV 109 G ++L+ V+ G+A+V G TG+ Sbjct: 395 GQQAAYQLLALVITLGIAIVSGLITGL 421 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 8.7 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -2 Query: 238 AEDPARVNEGTGAGVEQTTGRNSDA*MDLVGLVSEGNQGVGTLHTG 101 A DP N T VE ++ D + +EG V ++H G Sbjct: 128 ATDPGEHNGDTVTDVEAGLASRTNPLDDSISQANEGFCAVISMHDG 173 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 8.7 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -2 Query: 238 AEDPARVNEGTGAGVEQTTGRNSDA*MDLVGLVSEGNQGVGTLHTG 101 A DP N T VE ++ D + +EG V ++H G Sbjct: 123 ATDPGEHNGDTVTDVEAGLASRTNPLDDSISQANEGFCAVISMHDG 168 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,240 Number of Sequences: 438 Number of extensions: 4206 Number of successful extensions: 16 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16626408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -