BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c22r (709 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 38 0.32 UniRef50_Q5APK1 Cluster: Potential mitochondrial protein; n=1; C... 37 0.42 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 37.5 bits (83), Expect = 0.32 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 504 AGWWYLPVRTHKTSYRQY 557 A WWYLP RTHK SY +Y Sbjct: 569 AEWWYLPARTHKRSYHRY 586 >UniRef50_Q5APK1 Cluster: Potential mitochondrial protein; n=1; Candida albicans|Rep: Potential mitochondrial protein - Candida albicans (Yeast) Length = 226 Score = 37.1 bits (82), Expect = 0.42 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Frame = +1 Query: 169 VVGRNSQLISFLHWHYYFNIELLRKKNNYYIKWSIFIYSKDDRIEY-VIFFK 321 ++G+ SQ+I F+ YF IE L KN +I W+ FI ++I +FF+ Sbjct: 156 IIGKLSQVIVFVSLSSYFLIEFLENKNIIHIPWNYFITIGKEKINLKQLFFE 207 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,819,616 Number of Sequences: 1657284 Number of extensions: 12353993 Number of successful extensions: 25012 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25006 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56611575523 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -