BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c22r (709 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0024 - 15563574-15563632,15563887-15563914,15564017-155642... 30 2.1 >06_03_0024 - 15563574-15563632,15563887-15563914,15564017-15564202, 15564283-15564332,15564435-15564691,15564772-15564910, 15565627-15565716,15567354-15567663 Length = 372 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +1 Query: 520 YPCGLTRRPTASISDL*NFHSGIHSLTFVKYVHISL*KLATVPDSKIGTVASIDTSA 690 YP T +S L H+G HSL + ++ I L++ PD + +I T++ Sbjct: 271 YPVTATDHAPQEVSMLDTSHNGTHSLNLISHLFIWK-SLSSFPDQSVFCAVAISTTS 326 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,396,914 Number of Sequences: 37544 Number of extensions: 309436 Number of successful extensions: 537 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -