BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c20r (582 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0129 + 17520753-17520842,17521651-17521741,17521887-175220... 171 5e-43 09_04_0527 - 18337968-18338077,18338440-18341212 29 2.0 10_08_0669 + 19742140-19742189,19742886-19742923,19744260-197444... 28 4.7 02_01_0385 + 2783387-2783695,2784149-2785082,2785206-2785309,278... 28 4.7 11_01_0645 + 5185341-5185568,5185773-5185823 27 8.2 03_02_0901 + 12267042-12267182,12267949-12268095,12268163-122682... 27 8.2 >03_04_0129 + 17520753-17520842,17521651-17521741,17521887-17522070, 17522149-17522224 Length = 146 Score = 171 bits (415), Expect = 5e-43 Identities = 74/134 (55%), Positives = 103/134 (76%) Frame = -3 Query: 442 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHI 263 TVKDV + VK +AHLK++GK+++PE +D+VKTARFKEL PYDPDW+Y R A+I R I Sbjct: 8 TVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIARKI 67 Query: 262 YIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILT 83 Y+R +GV KI+GGR+RNG P HFC+SSG+I+R LQ L+ + +++ GGR++T Sbjct: 68 YLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDPKGGRLIT 127 Query: 82 TQGRRDLDRIAAQV 41 +QGRRDLD++A +V Sbjct: 128 SQGRRDLDQVAGRV 141 >09_04_0527 - 18337968-18338077,18338440-18341212 Length = 960 Score = 29.5 bits (63), Expect = 2.0 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = -3 Query: 565 QGKVCNFACPHGYSL-NIRNIPLQ*NFLNSKITIYFCKMRSVTVKDVEQDKIVKTVAAHL 389 +G + N H SL +R+IP+ FL+S YF +M S V+++ KI H Sbjct: 862 EGALANLHYLHIDSLMELRDIPVGIEFLSSVKEAYFTRMHSDFVRNLRTGKISHIPKVHW 921 Query: 388 KKTG 377 G Sbjct: 922 STQG 925 >10_08_0669 + 19742140-19742189,19742886-19742923,19744260-19744448, 19746402-19748188 Length = 687 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = -3 Query: 187 SHFCRSSGSIARKALQSL-----EALKLVEKVQDGGRILTTQGRRDLDRIAAQVRLKAKQ 23 SH C S S+ R+ LQS+ EA +L + ++ R Q + DLD +A ++ L + Sbjct: 193 SHPCFSKNSLCRELLQSVAATLAEAAELGARCREPPRAGKLQMQSDLDALAGKLDLNLRD 252 Query: 22 QA 17 A Sbjct: 253 CA 254 >02_01_0385 + 2783387-2783695,2784149-2785082,2785206-2785309, 2785402-2785486,2785517-2787578,2787732-2787753, 2788157-2788327,2791473-2791517,2792558-2793874, 2793962-2794012,2794090-2794188,2794352-2794504, 2794554-2794571 Length = 1789 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 335 SCLYKIHVLRYLDFARFF*VS-SDSFNNLVLFNILYCDGTHL 457 S +YK+ +LRYLD + S S SFN+L+ L T+L Sbjct: 550 SSVYKLKLLRYLDASSLRISSFSKSFNHLLNLQALILSNTYL 591 >11_01_0645 + 5185341-5185568,5185773-5185823 Length = 92 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -3 Query: 265 IYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARK 149 ++ +SP + + + GR+R G P R +G IA + Sbjct: 18 VHCKSPAALLGIESPYSGRRRVGARPRGGSRQAGQIAER 56 >03_02_0901 + 12267042-12267182,12267949-12268095,12268163-12268253, 12268367-12268485,12268779-12268969,12269440-12269650, 12270072-12270309,12270944-12271329,12271933-12271956, 12271984-12272077,12272341-12272525,12273025-12273255, 12273665-12273730,12273816-12274034,12274764-12275003, 12275244-12275423,12276269-12276535,12276612-12276815, 12276896-12277048 Length = 1128 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = -3 Query: 424 QDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHIY 260 +D+I+ + ++ V+VP + +LV TA L P D W +R A LR + Sbjct: 947 EDRILMSDIVFMRAWVNVEVPTYCNLVTTA----LQPQDETWQGMRTTAELRRAH 997 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,754,770 Number of Sequences: 37544 Number of extensions: 309219 Number of successful extensions: 796 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -