BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c20f (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) 99 1e-21 SB_8022| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44946| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_9755| Best HMM Match : Sushi (HMM E-Value=0) 29 4.0 SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_36204| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 27 9.1 >SB_54531| Best HMM Match : Ribosomal_S19e (HMM E-Value=5e-30) Length = 92 Score = 99 bits (238), Expect = 1e-21 Identities = 52/110 (47%), Positives = 67/110 (60%) Frame = +3 Query: 201 TGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKR 380 +G +K+P+ +DLVKT +FKELAPYDPDW+Y+R GRK Sbjct: 2 SGNLKIPDWVDLVKTGKFKELAPYDPDWYYIRA-----------------------GRKN 38 Query: 381 NGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLDRI 530 G PSHF S S+AR L+ LE +KLVEK GGR +T+QG+RD+DRI Sbjct: 39 RGSAPSHFEVGSASVARSVLKGLEQIKLVEKASTGGRNITSQGQRDMDRI 88 >SB_8022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 30.3 bits (65), Expect = 1.3 Identities = 30/115 (26%), Positives = 46/115 (40%), Gaps = 1/115 (0%) Frame = +3 Query: 141 TVKDVEQDKIVKTVAAHLKKTGKVKVPEHMD-LVKTARFKELAPYDPDWFYVRCAAILRH 317 TV V K KT ++VP ++ L T R E+ + W V+C Sbjct: 221 TVNKVTGRKYTKTFVIMSGSNRPMRVPHSLEPLTLTNRVAEVT-FCRSWNAVKCTKYCAL 279 Query: 318 IYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQD 482 IY+ S + + V K+ GRK T + S + + S E L L +V + Sbjct: 280 IYLHSRLDTQPVNKVI-GRK---YTKTFVIMSGPNRPMRVPHSSEPLTLTNRVAE 330 >SB_44946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +3 Query: 279 DWFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEAL 458 D +YVR A + I + G + +I R+R VTPS S G + L L+ + Sbjct: 57 DQWYVRDACVSPSENISTNYGSPKLPRIVETRQRGDVTPSPLVLSRGISRERLLTKLDRM 116 Query: 459 KL 464 +L Sbjct: 117 QL 118 >SB_9024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +2 Query: 329 LTCWSQDC---HQDLRWAQT*WSYTFTFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 490 ++C ++DC + L +T S T TF ++ C +GF ++G +S+G+WS Sbjct: 262 VSCKARDCGPLNTPLNGTKT-GSLT-TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 316 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +2 Query: 398 TFLQVIRQYCTQGFAIVGG-IEAC*ESSGRWS 490 TF + C +GF ++G + +C +SSG+WS Sbjct: 112 TFPNKVTFSCDEGFILIGSPLRSC-QSSGKWS 142 >SB_9755| Best HMM Match : Sushi (HMM E-Value=0) Length = 1351 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 398 TFLQVIRQYCTQGFAIVGGIEAC*ESSGRWS 490 TF ++ C +GF ++G +S+G+WS Sbjct: 21 TFPNTVKFMCDEGFNLIGSRNRTCQSNGKWS 51 >SB_38543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 28.3 bits (60), Expect = 5.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 152 C*TRQDC*NCRCSLKKNGQSQGT*AHGSCKDSSLQRAGSV 271 C QDC + RC +KNG + T A G CK S + ++ Sbjct: 301 CNCMQDCSSSRCFWRKNG-IECTPACGQCKGSDCTNSPAI 339 >SB_36204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 292 CVVLPSFVIFTFAHLLESRLSPRSSVG 372 C LP V+F H++ L P SSVG Sbjct: 26 CGTLPDLVMFRTGHIMRRALIPCSSVG 52 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 90 NFLNSKITIYFCKMRSVTVKDVEQDKIVKTVAAHLKKTGK 209 NF SK+T ++ + +KD E DK +A LK K Sbjct: 3707 NFAASKVTSFYLLRSARNIKDTE-DKAADLIAQQLKDVSK 3745 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,954,972 Number of Sequences: 59808 Number of extensions: 389082 Number of successful extensions: 851 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 851 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -