BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c18r (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.15c |||aldehyde dehydrogenase |Schizosaccharomyces pomb... 33 0.042 SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosacc... 31 0.13 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 27 2.1 SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3||... 27 2.8 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 27 3.7 SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related prote... 25 8.5 >SPBC21C3.15c |||aldehyde dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 522 Score = 33.1 bits (72), Expect = 0.042 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = +3 Query: 498 LDGVVEVIV*CKIYKLIELL-LGQRLVSDVEMSHVVFHIVIGQVESPFQKSSNSCHLVVF 674 LDGV + I+ K+Y I + LG +DV+M +V + +ES Q + + +V+ Sbjct: 282 LDGVYDTII-TKLYNRISTMRLGMYTQNDVDMGAMVSNNRFDHLESLIQDAVSKGARLVY 340 Query: 675 GGH 683 GGH Sbjct: 341 GGH 343 >SPBC646.02 |cwf11||complexed with Cdc5 protein Cwf11 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1284 Score = 31.5 bits (68), Expect = 0.13 Identities = 28/94 (29%), Positives = 40/94 (42%) Frame = -3 Query: 368 ELGYLLAVDAVPGQHIAEEDQLIIDRITTLWANFAKYGNPTPEPTDLLPVVWSTVEGNKR 189 E+G L A PG H A D + R + + KY N T + D + N+ Sbjct: 833 EIGRLAASIQAPGSHDASPDTALYFRDAYIKRLWEKYLN-TVDDKDSVDAY------NRF 885 Query: 188 PYLDIDTDLQLRSRPFHHRMAFWDLFYKLYGELE 87 P+ D R +++ F+D KLYGELE Sbjct: 886 PFHSYFGDKSKRPIETYNKDNFFDYATKLYGELE 919 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 27.5 bits (58), Expect = 2.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 221 VVWSTVEGNKRPYLDI 174 VVW +E NK+P+LD+ Sbjct: 2252 VVWHLLEDNKKPFLDV 2267 >SPCC1450.09c |||phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 633 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 142 STTGWPSGISSISSMENWNARNNS 71 +T+GWP G S +S+ E A N+S Sbjct: 453 ATSGWPDGSSLVSTYERVLATNSS 476 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 26.6 bits (56), Expect = 3.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -1 Query: 178 TSTPTCSSEAGPSTTGWPSGISSISSMEN---WNARNNSRNKR*TSTRYG 38 ++ PT S GP +G+PS ++ M WN+ N++ T+T G Sbjct: 897 SAPPTTSFTPGPGGSGYPSYSNTTQGMNTTSIWNSSNSTIVSNVTATITG 946 >SPBC25B2.01 ||SPBC2G5.08|elongation factor 1 alpha related protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 592 Score = 25.4 bits (53), Expect = 8.5 Identities = 19/74 (25%), Positives = 34/74 (45%) Frame = -3 Query: 641 LERAFNLTDNDMEDHVRHFYIGDETLTEKQFDEFIDFASDYYFNYAVQRSIKKSLADGNK 462 + R ++ + D++D+ G+E LTE+Q +EF + +K +AD Sbjct: 1 MSRHRDVKNLDLDDYELDEEPGEEELTEEQEEEFRSAVATVRETLLGVPISEKEIAD--- 57 Query: 461 EVYYYVFSYDGGRN 420 V+YY F + N Sbjct: 58 TVWYYYFDVEKSVN 71 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,808,880 Number of Sequences: 5004 Number of extensions: 53741 Number of successful extensions: 152 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -