BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c17r (405 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q232V3 Cluster: Putative uncharacterized protein; n=1; ... 33 2.9 UniRef50_Q5CSI0 Cluster: Putative uncharacterized protein; n=4; ... 31 8.7 >UniRef50_Q232V3 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 805 Score = 32.7 bits (71), Expect = 2.9 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -1 Query: 261 QVHFYKTSLPRKICPVLSVSNVVDIEMIVVKVIKLLMNRTREAPGRMYSV 112 Q H Y T+ CP+ + N + I+ + +IK ++N + P +SV Sbjct: 441 QAHRYATNHQPLNCPIQNCQNCIQIDNDIQSIIKEILNNEKNKPNLAHSV 490 >UniRef50_Q5CSI0 Cluster: Putative uncharacterized protein; n=4; Cryptosporidium|Rep: Putative uncharacterized protein - Cryptosporidium parvum Iowa II Length = 2087 Score = 31.1 bits (67), Expect = 8.7 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 356 INFYNISRVNYVYETEFVCQSSMVGMNV*QNSRSIFTKRVCLEK-SVLC 213 I + +++ NY+YE F + + +N +++SIF + + EK S +C Sbjct: 495 ITDFELAQYNYLYENVFSMKIKTILLNFKTSNKSIFLQEIVFEKESTIC 543 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 320,685,332 Number of Sequences: 1657284 Number of extensions: 5369613 Number of successful extensions: 10520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10517 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 17773009086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -