BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c17r (405 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 2.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.6 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 6.1 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 20 8.0 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 20 8.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 20 8.0 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.2 bits (45), Expect = 2.0 Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = -3 Query: 247 QNEFASKNLSCALRLKCCRHRNDRR*SYKVVNESDKRSARTDVQ----CAVCSIAYCSL 83 + +F + N+ R K + + + K++ DK+ +R+D Q C C C + Sbjct: 187 ETQFVAANVILKTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTIDICMRCHDQLCDM 245 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 4.6 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 Query: 76 PKEDYNTLCYIQ 111 P+ED +CY+Q Sbjct: 171 PREDDRVVCYVQ 182 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.6 bits (41), Expect = 6.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = +2 Query: 35 IQIYLYSINNIEHFLRKTTIRYATYSTL 118 I YL + ++ +FL + + TYS + Sbjct: 85 ISFYLEATDDFAYFLEVSNNNFKTYSNV 112 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 20.6 bits (41), Expect = 6.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 1 HIIRKRNFN*KYSNL 45 H+ RKR N K SN+ Sbjct: 94 HVFRKRRVNYKDSNI 108 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 20.2 bits (40), Expect = 8.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 270 TKQQVHFYKTSLPRKICPVLSVSNVVDIEMIVVKVI 163 T Q+H + ++C S+ +V I +I V +I Sbjct: 219 TLVQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLI 254 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 20.2 bits (40), Expect = 8.0 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 270 TKQQVHFYKTSLPRKICPVLSVSNVVDIEMIVVKVI 163 T Q+H + ++C S+ +V I +I V +I Sbjct: 219 TLVQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLI 254 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.2 bits (40), Expect = 8.0 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 201 LRRRAQDRFFEANSFCKNG 257 ++R A+DR + SF NG Sbjct: 884 IKREAEDRDEDERSFHSNG 902 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,305 Number of Sequences: 336 Number of extensions: 1524 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8752267 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -