BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c17r (405 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, ... 27 6.3 At4g15070.1 68417.m02315 DC1 domain-containing protein contains ... 27 6.3 At3g20780.1 68416.m02628 topoisomerase 6 subunit B (TOP6B) nearl... 26 8.3 >At5g35160.1 68418.m04167 endomembrane protein 70, putative p76, Homo sapiens, EMBL:HSU81006 Length = 627 Score = 26.6 bits (56), Expect = 6.3 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 320 YETEFVCQSSMVGMNV*QNSRSIFTKRVCLEKSVLCSPSQ 201 Y T C S+ V M+V + +F+ V E+S + PS+ Sbjct: 207 YTTPIKCDSTRVSMSVKEGQSIVFSYEVSFEESDIKWPSR 246 >At4g15070.1 68417.m02315 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 889 Score = 26.6 bits (56), Expect = 6.3 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 130 RTDVQCAVCSIAYCSLP 80 +T V C VCS+AY S P Sbjct: 522 KTSVTCNVCSLAYSSCP 538 >At3g20780.1 68416.m02628 topoisomerase 6 subunit B (TOP6B) nearly identical to topoisomerase 6 subunit B [Arabidopsis thaliana] GI:12331188 Length = 670 Score = 26.2 bits (55), Expect = 8.3 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -3 Query: 307 LFVSRRWSE*TCNKTAGPFLQNEFASKNLSCALRL 203 L + +R T KT FLQNEF + N + A RL Sbjct: 327 LLLIKRLITDTSKKTLLQFLQNEFVNINKTLAARL 361 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,026,090 Number of Sequences: 28952 Number of extensions: 122412 Number of successful extensions: 237 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 237 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 595686720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -