BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c12f (584 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC051733-1|AAH51733.1| 1026|Homo sapiens LUZP1 protein protein. 31 4.0 AK074153-1|BAB84979.1| 1046|Homo sapiens FLJ00226 protein protein. 31 4.0 AL031428-1|CAI19705.1| 1026|Homo sapiens leucine zipper protein ... 30 6.9 AB065537-1|BAC05783.1| 239|Homo sapiens seven transmembrane hel... 29 9.1 >BC051733-1|AAH51733.1| 1026|Homo sapiens LUZP1 protein protein. Length = 1026 Score = 30.7 bits (66), Expect = 4.0 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +3 Query: 99 VDLAESQRIVDGIIENW----ISRAQLRLSPFDPIVNNEYA 209 + LAE++R+ DG ++N +SR+ + + P DP+ N +A Sbjct: 853 LQLAEAERMADGPLKNRPETVVSRSSIIIKPSDPVERNSHA 893 >AK074153-1|BAB84979.1| 1046|Homo sapiens FLJ00226 protein protein. Length = 1046 Score = 30.7 bits (66), Expect = 4.0 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 4/41 (9%) Frame = +3 Query: 99 VDLAESQRIVDGIIENW----ISRAQLRLSPFDPIVNNEYA 209 + LAE++R+ DG ++N +SR+ + + P DP+ N +A Sbjct: 846 LQLAEAERMADGPLKNRPETVVSRSSIIIKPSDPVERNSHA 886 >AL031428-1|CAI19705.1| 1026|Homo sapiens leucine zipper protein 1 protein. Length = 1026 Score = 29.9 bits (64), Expect = 6.9 Identities = 14/41 (34%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = +3 Query: 99 VDLAESQRIVDGII----ENWISRAQLRLSPFDPIVNNEYA 209 + LAE++R+ DG + E +SR+ + + P DP+ N +A Sbjct: 853 LQLAEAERMADGPLKDRPETVVSRSSIIIKPSDPVERNSHA 893 >AB065537-1|BAC05783.1| 239|Homo sapiens seven transmembrane helix receptor protein. Length = 239 Score = 29.5 bits (63), Expect = 9.1 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 6/66 (9%) Frame = +3 Query: 66 VACVAAVPYGDVDLAESQRIVDG--IIENWI--SRAQLRLSPFDPIVNN--EYAGGWHLP 227 V C+ +P V ++Q G +IEN I + + RLS D +N+ ++AGGW L Sbjct: 76 VLCLTVIPKPGVLAIQAQLRYCGRNVIENCICANMSVSRLSCDDVTINHLYQFAGGWTLL 135 Query: 228 GGENIL 245 G + IL Sbjct: 136 GSDLIL 141 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,088,117 Number of Sequences: 237096 Number of extensions: 1317213 Number of successful extensions: 3559 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3557 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6098631048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -