BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c11r (681 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 25 2.2 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 5.1 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 6.7 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 8.9 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 25.0 bits (52), Expect = 2.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 328 HDHGGHQGHVTNVHWARGHNGGVSHDH 408 H H H G+ + G +GG +HDH Sbjct: 124 HHHHHHHGNNGGGNGGGGGSGGNAHDH 150 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 5.1 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +2 Query: 506 TFDCSGSTLSTGVALAASLMLIRMWTRGV 592 T CS TGV + S++L RM GV Sbjct: 1160 TVHCSAGVGRTGVFITLSIVLERMQYEGV 1188 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.4 bits (48), Expect = 6.7 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = -1 Query: 678 ESPDVGPALVEAPIVPSPVHVG---PLVPGQLTP 586 +S GP A + PSP G PL PG +TP Sbjct: 439 QSTSPGPDRSPATLTPSPGIGGPISPLDPGNVTP 472 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.0 bits (47), Expect = 8.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 119 NQLSLLIISKI*KNNQMTSSTCGFYMEI*FTKIYQVS 9 N+ L+ + +I KN+ F ++I T IY+ S Sbjct: 35 NEFDLMFVKEIFKNHNSNVVLSPFSVKILLTLIYEAS 71 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 474,574 Number of Sequences: 2352 Number of extensions: 7680 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68577420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -