BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c10f (658 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0786 - 7606984-7607037,7607235-7607379,7608103-7608163,760... 31 1.1 09_04_0259 - 16182190-16182360,16183185-16183262,16184431-161845... 29 2.5 12_01_0372 + 2867471-2867775,2867805-2867901,2868539-2868916 29 3.3 03_01_0389 + 3021849-3022136,3022237-3022753,3022835-3022988,302... 29 3.3 11_06_0156 + 20748472-20748951 29 4.3 10_02_0061 - 4812903-4812940,4813140-4813536 29 4.3 08_02_0590 + 19044193-19044364,19044464-19045047,19045085-190460... 29 4.3 05_03_0235 - 10747649-10748118,10748226-10748314,10748477-107485... 29 4.3 10_07_0168 + 13758189-13758418,13758888-13759041,13760576-137610... 28 5.7 12_02_0367 - 18053979-18054618,18055844-18055988,18056049-18056649 28 7.5 08_02_1480 + 27401923-27402158,27402847-27402982,27403119-274031... 28 7.5 08_02_0588 + 19036509-19039235 28 7.5 >08_01_0786 - 7606984-7607037,7607235-7607379,7608103-7608163, 7608273-7608465 Length = 150 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -1 Query: 307 ERVLVSKEAPQMEVLPFVSAITSPARWG*APAFAAEPPTILV 182 E + AP LPF S + + AR G APA +A P LV Sbjct: 2 EATAAAAAAPARSALPFRSRVAAAARPGRAPALSAAPGRRLV 43 >09_04_0259 - 16182190-16182360,16183185-16183262,16184431-16184586, 16184913-16185092,16185875-16186027 Length = 245 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +1 Query: 88 QKSPSNSTTTSRSVSPGPRVLDAPRKPLTSTVPG 189 ++ PS T T+ V PGP V D RKPL+ T PG Sbjct: 182 KEKPSIGTVTA--VGPGPLVEDGSRKPLSIT-PG 212 >12_01_0372 + 2867471-2867775,2867805-2867901,2868539-2868916 Length = 259 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 425 LDIGGGDPGASGEDVSCAKSEGELTSLGSPG 333 +++ G D S SC S+G ++ GSPG Sbjct: 169 MEVDGNDDSDSSSPTSCVSSDGRSSAGGSPG 199 >03_01_0389 + 3021849-3022136,3022237-3022753,3022835-3022988, 3023076-3023166,3024556-3024627,3026366-3026689 Length = 481 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +1 Query: 82 SWQKSPSNSTTTSRSVSPGPRVLDAPRKPLTSTVPGLWVVLPQTLVLTPI 231 +W K P N V+PG ++DA P +PGL P TL TP+ Sbjct: 36 AW-KRPGNGAAVPVVVAPGSPIMDADSWP---ALPGLASPPPTTLTPTPM 81 >11_06_0156 + 20748472-20748951 Length = 159 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 609 CWLPKQHRRSFRSRQPRPKY 550 CWLP+ RRS R R R K+ Sbjct: 6 CWLPRACRRSMRHRSCRTKF 25 >10_02_0061 - 4812903-4812940,4813140-4813536 Length = 144 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = +1 Query: 64 WRWRPWSW---QKSPSNSTTTSRSVSPGPRVLDAPRKP 168 WRWR W W + ++ST S++ G R+L R P Sbjct: 41 WRWRQWWWLEATRRANSSTAVGGSMAVG-RLLPRSRSP 77 >08_02_0590 + 19044193-19044364,19044464-19045047,19045085-19046059, 19046219-19046605 Length = 705 Score = 28.7 bits (61), Expect = 4.3 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = +3 Query: 204 AANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQARQFTLALGTAN 383 A N GA A V+ + +GR S+ +L + + AA WR+RR Q AL Sbjct: 49 AVNGGA----AEDVVVIASGRRSVGEPTLDVSEMLLQAAETWRSRRTQREARPDALPPRP 104 Query: 384 IFS---GGTRVTTSNVQMHGSYNM 446 + + GG+ TS + G M Sbjct: 105 VAADGRGGSGEGTSRARGRGEEGM 128 >05_03_0235 - 10747649-10748118,10748226-10748314,10748477-10748574, 10748934-10749046,10749107-10749200,10749557-10749589, 10749734-10749851,10750110-10750210,10751036-10751233, 10751337-10751471,10751752-10751830,10753650-10753738, 10753835-10753987,10754100-10754285 Length = 651 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 276 RWKFCHSSVRSQVQQDGGEHQRLRQNHPQSW 184 R + HS GG HQR R +HP +W Sbjct: 543 RHRHGHSHGDHHHHYHGGHHQRRRHHHPPAW 573 >10_07_0168 + 13758189-13758418,13758888-13759041,13760576-13761042, 13761361-13761478,13761566-13761622,13761906-13762082, 13762225-13762365,13762458-13762531,13764583-13764738, 13764822-13764895,13764992-13765068 Length = 574 Score = 28.3 bits (60), Expect = 5.7 Identities = 22/76 (28%), Positives = 32/76 (42%) Frame = +3 Query: 243 VIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQARQFTLALGTANIFSGGTRVTTSNV 422 VIA T + + S +NT S A C RR+ +A G A I G+ + S+ Sbjct: 160 VIAATYVDSMLGARSSTSNTESTAAVSCVPARRSMIE--IMAFGVAKILVRGSNMMKSDG 217 Query: 423 QMHGSYNMDTLHNDVA 470 G + L +VA Sbjct: 218 AASGERKIGILAFEVA 233 >12_02_0367 - 18053979-18054618,18055844-18055988,18056049-18056649 Length = 461 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +3 Query: 276 CGASLLTNTRSVTAAHC 326 CG+ ++T TRSVT A C Sbjct: 275 CGSRIITTTRSVTVASC 291 >08_02_1480 + 27401923-27402158,27402847-27402982,27403119-27403168, 27403810-27403813,27404394-27404494,27405084-27406305 Length = 582 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 355 SSPSLLAQLTSSPEAPGSPPP 417 SS S + +SSP AP SPPP Sbjct: 7 SSTSSSSSASSSPRAPSSPPP 27 >08_02_0588 + 19036509-19039235 Length = 908 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 243 VIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQ 347 V+ + +GR S+ +L + + AA WR+RR Q Sbjct: 185 VVVIVSGRRSVGEPTLDVSEMLLQAAQAWRSRRTQ 219 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,816,235 Number of Sequences: 37544 Number of extensions: 351534 Number of successful extensions: 1592 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1590 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -