BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c09r (771 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 26 0.34 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.5 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 5.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 7.3 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 26.2 bits (55), Expect = 0.34 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 6/48 (12%) Frame = +2 Query: 572 RPQLEHRRCLRS*QNQPGHRRP------HLEHRRCLRSLQNQPGHRRP 697 +P+ H R R + +PG+ RP H R R + +PG+ RP Sbjct: 108 QPRPPHPRLRREPEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRP 155 Score = 23.8 bits (49), Expect = 1.8 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 8/66 (12%) Frame = +2 Query: 572 RPQLEHRRCLRS*QNQ--PGHRRP------HLEHRRCLRSLQNQPGHRRPQLEHRGFPXS 727 +P+ H R R +++ PG+ RP H R R + +PG+ RP + P Sbjct: 80 QPRPPHPRLRREAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEPGNNRPVYIPQPRPPH 139 Query: 728 LQSRRE 745 + RRE Sbjct: 140 PRLRRE 145 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 5.5 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 107 IPEPCKCAIRLV 72 +PEPC+C R + Sbjct: 475 LPEPCRCHARCI 486 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.2 bits (45), Expect = 5.5 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 107 IPEPCKCAIRLV 72 +PEPC+C R + Sbjct: 475 LPEPCRCHARCI 486 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 270 SFAGVFTLTVLNDGVNYLNRA*VFWFSDIF 359 +F G+ L VLN N L F D+F Sbjct: 330 TFLGLIRLIVLNLSYNMLTHIDARMFKDLF 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,905 Number of Sequences: 438 Number of extensions: 3477 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -