BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c01f (563 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.47 SPAC22H10.11c ||||Schizosaccharomyces pombe|chr 1|||Manual 27 1.9 SPAC167.05 ||SPAC57A7.01|Usp |Schizosaccharomyces pombe|chr 1|||... 27 2.5 SPBC947.06c |||spermidine family transporter |Schizosaccharomyce... 26 3.3 SPCC417.08 |tef3||translation elongation factor eEF3|Schizosacch... 26 3.3 SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po... 25 5.8 SPBP4H10.20 |nhm1|DcpS|m7G|Schizosaccharomyces pombe|chr 2|||Manual 25 7.7 SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|c... 25 7.7 SPAC26F1.04c |etr1||enoyl-[acyl-carrier protein] reductase|Schiz... 25 7.7 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 29.1 bits (62), Expect = 0.47 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 348 INVNRPSEIAADPVDVEDIAEEPLPEVVILPTPVFPE 458 I+ N P+ A+ P+ E + EEPLP LP PE Sbjct: 80 ISKNEPTSEASKPLLNELVPEEPLPREPPLPNEPVPE 116 >SPAC22H10.11c ||||Schizosaccharomyces pombe|chr 1|||Manual Length = 629 Score = 27.1 bits (57), Expect = 1.9 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -1 Query: 389 NGISGNLGRTVHVDDDLDEGSAISAGDSHRGTFNNGRSNRDGLVGVNKS-RSDGDGLVGV 213 NG S + ++D+ S + D +FN+ R R VN RSD D L+G+ Sbjct: 194 NGFSTSTEEEEEEEEDIVSASWVDNLDMDMASFNSHRE-RFLTEHVNMDERSDDDFLLGL 252 Query: 212 NKSRSNRDGH 183 S S+ D H Sbjct: 253 ISSDSSVDDH 262 >SPAC167.05 ||SPAC57A7.01|Usp |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 26.6 bits (56), Expect = 2.5 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 354 VNRPSEIAADPVDVEDIAEEPLPEVVILPTPVFPEN 461 ++ P++ A+ V E E+P+P V+ P PV N Sbjct: 200 LSSPTQGASSNVTPESPPEKPIPSFVLSPPPVSATN 235 >SPBC947.06c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 498 Score = 26.2 bits (55), Expect = 3.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 228 ISVGPALVDTYEPISVGPAIVEGAPVTVTGADGTPLVQIII 350 +S G + D + P G A++ A V+GAD P++ ++ Sbjct: 164 VSSGGVMADLWCPAQRGTALIFYAFFVVSGADFGPIISSLV 204 >SPCC417.08 |tef3||translation elongation factor eEF3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1047 Score = 26.2 bits (55), Expect = 3.3 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -1 Query: 455 RKYG-SGENNNFGQRLFGNVLN--INGISGNLGRTVHVDDDLDEGSA 324 R+YG G N + L ++N + G +L RTV+V+ D+DE A Sbjct: 461 RRYGLCGPNGSGKSTLMRAIVNGQVEGFPTHL-RTVYVEHDIDESEA 506 >SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces pombe|chr 3|||Manual Length = 401 Score = 25.4 bits (53), Expect = 5.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 369 EIAADPVDVEDIAEEPLPEVVILPTPVFPEN 461 E+ P D+E I E +PE V+ FPEN Sbjct: 285 ELLFSPSDIE-IREAGIPEAVMQSVTHFPEN 314 >SPBP4H10.20 |nhm1|DcpS|m7G|Schizosaccharomyces pombe|chr 2|||Manual Length = 304 Score = 25.0 bits (52), Expect = 7.7 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -1 Query: 359 VHVDDDLDEGSAISAGDSHRGTFNNGRSNRDGLVGVNKSRSDGD 228 +HVD + +GSA+ + R++ DGL VN + + G+ Sbjct: 248 LHVDHETGDGSAVGRAILLDDVIDRLRNSPDGLENVNITFNIGE 291 >SPCC584.15c |||arrestin/PY protein 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 594 Score = 25.0 bits (52), Expect = 7.7 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = +3 Query: 321 DGTPLVQIIINVNRPSEIAADPVDVEDIAEEPLPEVVILPTPVFP 455 DG P + + P+E P + IA P+P ++ P P Sbjct: 524 DGLPRYEEATRPSSPTESVEIPSNTTTIAPSPVPTIIAPALPSTP 568 >SPAC26F1.04c |etr1||enoyl-[acyl-carrier protein] reductase|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 25.0 bits (52), Expect = 7.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -1 Query: 323 ISAGDSHRGTFNNGRSNRDGLVGVNKSRS----DGDGLVGVNKS 204 + GD +GTF+ G+ G V + R+ DG LV V+KS Sbjct: 100 VDVGDQFKGTFSPGQWAILGSVNLGSWRTEMNIDGRSLVPVDKS 143 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,845,293 Number of Sequences: 5004 Number of extensions: 37692 Number of successful extensions: 116 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -