BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12c01f (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 25 2.3 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 25 2.3 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 25 2.3 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 3.0 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 24 3.9 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 6.9 DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 9.1 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 23 9.1 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 9.1 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 435 LPTPVFPENRRS*TRGAPQPC 497 LP + P N+RS + P PC Sbjct: 127 LPLGILPSNQRSSSSSKPTPC 147 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 435 LPTPVFPENRRS*TRGAPQPC 497 LP + P N+RS + P PC Sbjct: 127 LPLGILPSNQRSSSSSKPTPC 147 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 435 LPTPVFPENRRS*TRGAPQPC 497 LP + P N+RS + P PC Sbjct: 127 LPLGILPSNQRSSSSSKPTPC 147 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 24.2 bits (50), Expect = 3.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -3 Query: 246 EQVRRRWARRCQQEQVQQR 190 +Q R+RW ++ Q++Q QQR Sbjct: 188 DQQRQRWRQQQQKQQRQQR 206 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/36 (22%), Positives = 18/36 (50%) Frame = +3 Query: 246 LVDTYEPISVGPAIVEGAPVTVTGADGTPLVQIIIN 353 +++ + + +EG +TV DG P+ + +N Sbjct: 390 MINAFASVCPAQVTIEGHALTVIATDGEPVHPVQVN 425 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 6.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 399 DIAEEPLPEVVILPTPVFPENRR 467 D+ E P I+P P FP+ R+ Sbjct: 546 DMKEAPTTNPRIVPIPTFPQIRK 568 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 213 DTYEPISVGPALVDTYEPISVGPAIVEGAPVT 308 +T E +V P DT EP+++ P+T Sbjct: 433 ETMEQTTVVPEAADTTEPLTIETTSQSFVPLT 464 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 22.6 bits (46), Expect = 9.1 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +3 Query: 231 SVGPALVDTYEPISVGPAIVEGAPVTVTGADGT 329 +V P T P V PVT TG+ T Sbjct: 50 TVAPTTTTTVAPGQTTTTTVASGPVTTTGSTDT 82 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 22.6 bits (46), Expect = 9.1 Identities = 13/51 (25%), Positives = 17/51 (33%) Frame = +3 Query: 177 TYVPISVGPALVDTYEPISVGPALVDTYEPISVGPAIVEGAPVTVTGADGT 329 T P + T ++ G T P V PVT TG+ T Sbjct: 42 TVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQTTTTTVASGPVTTTGSTDT 92 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,130 Number of Sequences: 2352 Number of extensions: 10461 Number of successful extensions: 35 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -