BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b21r (312 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 1.1 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 2.6 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 23 3.5 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 21 8.1 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = -3 Query: 136 RRTLRMSSSRFDAQGSCTPWSSLTKRRLRNLS 41 +RT+ M S++DA+ + ++ T R +R++S Sbjct: 938 QRTITMWQSQWDAEADTSRYTRWTHRIIRDIS 969 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 197 KDIKDFLIKARRKDAKSVKI 138 K++KDF+I RR D +++ Sbjct: 416 KELKDFIIMGRRTDKALLRL 435 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 15 NLETWR*TLLKFLSLLFVSDDQGVQEP*ASNLELDILRVLL 137 ++E+W +L+ + F D GV+ P +D+L +L Sbjct: 323 DIESWLPRVLEAIDAGFAVSDDGVRVPLDETRGIDVLGNIL 363 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 21.4 bits (43), Expect = 8.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 52 SAFSLSVMTRVYRNLEHRTLNLT 120 S F + VM V EH+ +NLT Sbjct: 222 STFDVQVMPSVIPLEEHQAVNLT 244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 283,995 Number of Sequences: 2352 Number of extensions: 5053 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 20316549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -