BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b18r (706 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41039-4|AAL11489.1| 452|Caenorhabditis elegans Synapse defecti... 29 2.4 U41039-3|AAK68627.2| 537|Caenorhabditis elegans Synapse defecti... 29 2.4 U80952-2|AAB38094.1| 309|Caenorhabditis elegans Muscle attachme... 28 7.5 U80952-1|AAU20846.1| 315|Caenorhabditis elegans Muscle attachme... 28 7.5 Z81583-6|CAB04674.1| 397|Caenorhabditis elegans Hypothetical pr... 27 9.9 Z81091-2|CAB03143.2| 2972|Caenorhabditis elegans Hypothetical pr... 27 9.9 >U41039-4|AAL11489.1| 452|Caenorhabditis elegans Synapse defective protein 9, isoformd protein. Length = 452 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 307 HMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRH 405 H + HT K CKFC + N K++++H Sbjct: 83 HRSVHTALKPYVCKFCGKSSRLKGNLTKHILKH 115 >U41039-3|AAK68627.2| 537|Caenorhabditis elegans Synapse defective protein 9, isoformc protein. Length = 537 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 307 HMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRH 405 H + HT K CKFC + N K++++H Sbjct: 66 HRSVHTALKPYVCKFCGKSSRLKGNLTKHILKH 98 >U80952-2|AAB38094.1| 309|Caenorhabditis elegans Muscle attachment abnormal protein1, isoform a protein. Length = 309 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 298 LTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRHAT 411 LT HM HT K C C N + ++ ++ RH+T Sbjct: 271 LTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRHST 308 >U80952-1|AAU20846.1| 315|Caenorhabditis elegans Muscle attachment abnormal protein1, isoform b protein. Length = 315 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 298 LTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRHAT 411 LT HM HT K C C N + ++ ++ RH+T Sbjct: 277 LTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMKRHST 314 >Z81583-6|CAB04674.1| 397|Caenorhabditis elegans Hypothetical protein T02G6.6 protein. Length = 397 Score = 27.5 bits (58), Expect = 9.9 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 188 KVNSQKINLTCKHHFEINCLLDFQFTTLFSFI 283 +V ++ L C +F+++ + FTT FSF+ Sbjct: 190 RVEDYELRLECSKNFDLSHFFVWNFTTHFSFV 221 >Z81091-2|CAB03143.2| 2972|Caenorhabditis elegans Hypothetical protein F55H12.3 protein. Length = 2972 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 155 SCSLHYTNTKSKVNSQKINLTCK-HHFEINC 244 +CS+ NT +KV+ + N TC+ +F NC Sbjct: 1776 TCSIFNYNTTTKVSIESYNCTCQTGYFGTNC 1806 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,084,956 Number of Sequences: 27780 Number of extensions: 269752 Number of successful extensions: 658 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -