BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b18f (635 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 24 1.2 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 24 1.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.1 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.8 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 22 4.9 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 552 LTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRHA 442 +T HM TH+ + C+ C S + K+L H+ Sbjct: 65 VTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHS 101 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 552 LTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRHA 442 LT H+ TH+ K C C S ++ ++ H+ Sbjct: 37 LTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHS 73 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.8 bits (49), Expect = 1.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -3 Query: 552 LTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRHA 442 +T HM TH+ + C+ C S + K+L H+ Sbjct: 321 VTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHS 357 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 552 LTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRHA 442 LT H+ TH+ K C C S ++ ++ H+ Sbjct: 293 LTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHS 329 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = -3 Query: 564 YSLILTCHMNTHTYTK*TDCKFCTNNKSCDNNYFKYLIRH 445 Y +L H THT K +C+ C + D++ ++ H Sbjct: 146 YKHVLQNHERTHTGEKPFECQECHKRFTRDHHLKTHMRLH 185 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 2.8 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 14/67 (20%) Frame = -2 Query: 181 RIVYIYFINRSFNVN---LACS---IVRNVIYW*FI------LLL*YGHNY--LILICAL 44 RI Y Y ++ +FNV+ L CS V + Y FI LL Y Y +IL+C Sbjct: 55 RIYYFYCVSITFNVHLLFLLCSGYFTVHLLFYCPFIIFTVHFLLCTYYFYYAFIILLCVY 114 Query: 43 LIYSPFV 23 Y F+ Sbjct: 115 YFYYAFI 121 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 555 ILTCHMNTHTYTK*TDCKFC 496 +L H+ THT K C +C Sbjct: 22 LLQGHIRTHTGEKPFSCTYC 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,613 Number of Sequences: 336 Number of extensions: 2958 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -