BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b18f (635 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11230.1 68416.m01366 yippee family protein similar to qdgl-1... 30 1.5 At4g03140.1 68417.m00427 short-chain dehydrogenase/reductase (SD... 29 3.4 At3g08990.1 68416.m01051 yippee family protein similar to qdgl-1... 28 6.0 >At3g11230.1 68416.m01366 yippee family protein similar to qdgl-1 [Coturnix coturnix] GI:10441650, Yippee protein [Homo sapiens] GI:5713281; contains Pfam profile PF03226: Yippee putative zinc-binding protein Length = 129 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +2 Query: 170 INNPIGNQSEVIAIQGYLTEADILCIKIIEAVECESYVLWFIDFLIQKDRK 322 +N G + + + + G T DI C+K C SYV W +F +K++K Sbjct: 48 VNVYAGKKEDRMMMTGMHTVVDIYCVK------CGSYVGWKYEFAFEKNQK 92 >At4g03140.1 68417.m00427 short-chain dehydrogenase/reductase (SDR) family protein similar to stem secoisolariciresinol dehydrogenase GI:13752458 from {Forsythia x intermedia}; similar to sex determination protein tasselseed 2 SP:P50160 from [Zea mays] Length = 279 Score = 28.7 bits (61), Expect = 3.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 632 CKHHLRSNCLLDFQFTTXF 576 CKH +R NC+ F TT F Sbjct: 183 CKHRIRVNCISPFAITTSF 201 >At3g08990.1 68416.m01051 yippee family protein similar to qdgl-1 [Coturnix coturnix] GI:10441650, Yippee protein [Drosophila melanogaster] GI:5713279; contains Pfam profile PF03226: Yippee putative zinc-binding protein Length = 128 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = +2 Query: 170 INNPIGNQSEVIAIQGYLTEADILCIKIIEAVECESYVLWFIDFLIQKDRK 322 +N +G + + I G+ T ADI C V C S V W + K +K Sbjct: 48 VNVTVGEKEHRVMITGWHTVADIFC------VSCGSLVGWKYEIAYDKSQK 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,431,872 Number of Sequences: 28952 Number of extensions: 209647 Number of successful extensions: 427 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -