BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b15r (669 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0083 + 4081564-4081677,4081853-4082359 29 3.3 >09_02_0083 + 4081564-4081677,4081853-4082359 Length = 206 Score = 29.1 bits (62), Expect = 3.3 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 4/83 (4%) Frame = -3 Query: 637 IFDCLCLL-PYVILERPLVINHQMST*KNVEPLHVLLSL*KMRKGNFYFNNRELYKI--- 470 I LC++ ++ PL + Q+ K+VE + +LLS+ G Y+ + L + Sbjct: 75 IVGILCVIFDTIMYSSPLTVMSQVVKTKSVEYMPLLLSVVSFLNG-LYWTSYTLIRFDIF 133 Query: 469 LSLSWLMYFAVGAIQIMIYVLYY 401 +++ + A+Q+++YV+YY Sbjct: 134 ITIPNGLGVLFAAVQLILYVIYY 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,105,864 Number of Sequences: 37544 Number of extensions: 268311 Number of successful extensions: 389 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -