BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b15r (669 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23172-11|AAL27245.1| 327|Caenorhabditis elegans Hypothetical p... 28 5.2 U23172-10|AAM22066.1| 352|Caenorhabditis elegans Hypothetical p... 28 5.2 U23172-9|AAK67227.1| 362|Caenorhabditis elegans Hypothetical pr... 28 5.2 U23172-7|AAK67228.1| 376|Caenorhabditis elegans Hypothetical pr... 28 5.2 AC098856-5|AAR12980.1| 263|Caenorhabditis elegans Hypothetical ... 28 6.9 >U23172-11|AAL27245.1| 327|Caenorhabditis elegans Hypothetical protein F25B5.3c protein. Length = 327 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 484 LDC*NKNYPFSFSINLTKHVVVPH 555 +D NK YP FS NLT +PH Sbjct: 109 VDLKNKYYPIEFSPNLTMEEKIPH 132 >U23172-10|AAM22066.1| 352|Caenorhabditis elegans Hypothetical protein F25B5.3d protein. Length = 352 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 484 LDC*NKNYPFSFSINLTKHVVVPH 555 +D NK YP FS NLT +PH Sbjct: 134 VDLKNKYYPIEFSPNLTMEEKIPH 157 >U23172-9|AAK67227.1| 362|Caenorhabditis elegans Hypothetical protein F25B5.3a protein. Length = 362 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 484 LDC*NKNYPFSFSINLTKHVVVPH 555 +D NK YP FS NLT +PH Sbjct: 144 VDLKNKYYPIEFSPNLTMEEKIPH 167 >U23172-7|AAK67228.1| 376|Caenorhabditis elegans Hypothetical protein F25B5.3b protein. Length = 376 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 484 LDC*NKNYPFSFSINLTKHVVVPH 555 +D NK YP FS NLT +PH Sbjct: 158 VDLKNKYYPIEFSPNLTMEEKIPH 181 >AC098856-5|AAR12980.1| 263|Caenorhabditis elegans Hypothetical protein Y37F4.5 protein. Length = 263 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 459 DKDKILYNSRLLK*KLPFLIFYKLNKTCSGSTFFY 563 ++ +++Y S+ LK K+P L YK+ + +F Y Sbjct: 43 ERGQLIYTSKQLKSKIPGLSVYKVRRIEDNHSFLY 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,552,588 Number of Sequences: 27780 Number of extensions: 295695 Number of successful extensions: 556 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -