BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b10r (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 3.9 M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 21 9.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.0 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 409 SKVVIEEPPLEENLNRIQLDGELAQTV 329 + + ++EPPL +NLN + L L T+ Sbjct: 239 ANISLDEPPLGKNLN-LSLHASLNHTL 264 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 21.4 bits (43), Expect = 9.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 277 EKRLKAAFTAFEQINLPRLKAENPSLRLSQLKEL 176 EKR + AF+A + L R AEN L + ++L Sbjct: 20 EKRPRTAFSAEQLARLKREFAENRYLTERRRQQL 53 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -1 Query: 258 PSQPLNKSICHVLKPRTLRSGFLS 187 P QP + + C L +T+R ++S Sbjct: 1081 PEQPPHDTTCTTLTSQTIRISWMS 1104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,962 Number of Sequences: 438 Number of extensions: 2789 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -