BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b10f (604 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 24 3.3 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 24 3.3 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.6 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 186 FTHAL-LLHMYISILFYYIYIHWER 115 F + L L+ I ++ YIY HWER Sbjct: 2 FVYTLALVAAVIFLVLRYIYSHWER 26 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 186 FTHAL-LLHMYISILFYYIYIHWER 115 F + L L+ I ++ YIY HWER Sbjct: 2 FVYTLALVAAVIFLVLRYIYSHWER 26 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 7.6 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -3 Query: 269 LLFSPVNFFGILCKYWNIENTYISFVKISHM 177 L+FSP N F I C + +T+ + + + M Sbjct: 837 LIFSPTNRFRIFCHWLCNHSTFGNIILVCIM 867 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,138 Number of Sequences: 2352 Number of extensions: 9009 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -