BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b10f (604 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051423-1|AAK92847.1| 213|Drosophila melanogaster GH10002p pro... 43 4e-04 AE014297-2618|AAF55628.1| 213|Drosophila melanogaster CG6013-PA... 43 4e-04 >AY051423-1|AAK92847.1| 213|Drosophila melanogaster GH10002p protein. Length = 213 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = +1 Query: 238 MPKKFTGENSKAVAARQRKENAKLEKDQKTKKAVEDAEWEDN 363 MPKK G NSKAV AR+RKE K +K K ED W D+ Sbjct: 1 MPKKM-GINSKAVEARERKEATKKATQEKKSKEAEDRLWRDD 41 >AE014297-2618|AAF55628.1| 213|Drosophila melanogaster CG6013-PA protein. Length = 213 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = +1 Query: 238 MPKKFTGENSKAVAARQRKENAKLEKDQKTKKAVEDAEWEDN 363 MPKK G NSKAV AR+RKE K +K K ED W D+ Sbjct: 1 MPKKM-GINSKAVEARERKEATKKATQEKKSKEAEDRLWRDD 41 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,294,977 Number of Sequences: 53049 Number of extensions: 362134 Number of successful extensions: 960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2462276481 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -