BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b06f (655 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z47357-10|CAA87427.3| 426|Caenorhabditis elegans Hypothetical p... 83 2e-16 AC024757-5|AAK68430.1| 814|Caenorhabditis elegans Hypothetical ... 31 0.94 >Z47357-10|CAA87427.3| 426|Caenorhabditis elegans Hypothetical protein ZK1128.1 protein. Length = 426 Score = 83.0 bits (196), Expect = 2e-16 Identities = 42/96 (43%), Positives = 62/96 (64%), Gaps = 4/96 (4%) Frame = +1 Query: 310 REYSYKTIKRPDPRTLKMPTPESAPNLIEIIKEKIRLNGPITVAEYMHIVTTNPTEGYYM 489 R+YS + +K P +PE +L + + +KIR++GPITVAEYM + P GYY Sbjct: 14 RQYSKQILKPPG-----YASPEKTNHLKKFLVDKIRVSGPITVAEYMKTCVSAPLVGYYG 68 Query: 490 K----KEVIGEAGDFITSPEISQLFGEILGIWFYAE 585 + ++V G GDFITSPE++QLFGE++G+W + E Sbjct: 69 QFSKDQKVFGAKGDFITSPELTQLFGEMIGVWVFHE 104 >AC024757-5|AAK68430.1| 814|Caenorhabditis elegans Hypothetical protein Y37E11AL.8 protein. Length = 814 Score = 30.7 bits (66), Expect = 0.94 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 325 KTIKRPDPRTLKMPTPESAPNLIEIIKEKIRLNGPITVA 441 K +++ DP +K+ P P+L ++I+ L G +T A Sbjct: 75 KCVEKQDPAEIKVSAPRPTPSLDDVIERSPELLGSLTTA 113 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,780,919 Number of Sequences: 27780 Number of extensions: 219259 Number of successful extensions: 685 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -