BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12b02f (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1772 + 29411874-29413218,29413355-29413421,29413749-294138... 30 1.8 03_05_1133 - 30614901-30615389,30615823-30615933,30616113-306161... 30 1.8 06_01_0313 - 2250312-2250516,2250585-2250610,2250792-2251076,225... 27 9.7 03_05_0769 - 27579251-27579934 27 9.7 >07_03_1772 + 29411874-29413218,29413355-29413421,29413749-29413896, 29415293-29415416,29416340-29416590,29416923-29418449, 29418786-29418896,29419576-29419734,29419827-29421734 Length = 1879 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +3 Query: 450 QKQVAICNYVCN*VVFLSIDNIGKHS*LHITQTIKTSSSSACISPLLDVNLSH 608 +K V N+ VV +D + +H+ + TQ + SSS+ SPLL + +++ Sbjct: 500 EKPVTTRNHAYAEVVVFVLDQMTRHTQVTSTQRKQARSSSSSASPLLSLRITY 552 >03_05_1133 - 30614901-30615389,30615823-30615933,30616113-30616178, 30616347-30616406,30616493-30616801,30616960-30617108, 30617200-30617269,30617370-30617494,30617516-30617573, 30618176-30618370,30618585-30618857,30618950-30619120, 30619203-30619333,30619423-30619582,30619712-30619900, 30620023-30620118,30620381-30620611,30620715-30620853, 30620903-30621057,30621160-30621378 Length = 1131 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +2 Query: 47 KDFDYLAQKLYKMGCKLCGPKLSLCGLVLSVW 142 +D+D +A +MG C + +CGLV S+W Sbjct: 109 RDYDQIANLAKRMGLYRCR-NIEICGLVFSLW 139 >06_01_0313 - 2250312-2250516,2250585-2250610,2250792-2251076, 2251289-2251567,2251817-2252121,2252581-2252860, 2253209-2253475 Length = 548 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +2 Query: 218 DEKNPPHSIEDFVIEVEKGYTLNAQNCWIAALL 316 DE+ PP S +D + +E G + +C++ +L+ Sbjct: 180 DEEGPPDSSQDILKFLENGLSRTYNDCFVESLI 212 >03_05_0769 - 27579251-27579934 Length = 227 Score = 27.5 bits (58), Expect = 9.7 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 158 TLMGVFYYIRAVALLEDLPFDEKNPPHSIEDF-VIEVEKGYTLNAQNC 298 TL GV + V LL+ P N P ++DF V +++ TLN C Sbjct: 7 TLAGV---VLVVLLLQQAPVLRANDPDPLQDFCVADLDSEVTLNGYPC 51 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,504,749 Number of Sequences: 37544 Number of extensions: 314767 Number of successful extensions: 680 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -