BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a12r (542 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6100| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.037 SB_9335| Best HMM Match : 7tm_1 (HMM E-Value=8.1e-05) 32 0.26 SB_12896| Best HMM Match : Plasmodium_HRP (HMM E-Value=1.1) 31 0.46 SB_41317| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 28 4.3 SB_34802| Best HMM Match : SBP (HMM E-Value=7.9) 28 5.7 SB_28914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_19079| Best HMM Match : LCM (HMM E-Value=6.3e-37) 27 7.5 SB_54058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_48973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_6100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 35.1 bits (77), Expect = 0.037 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 251 FPWGDGQKSLFHNPHVN 201 FPWGDG LFHN H N Sbjct: 2 FPWGDGDPPLFHNKHTN 18 >SB_9335| Best HMM Match : 7tm_1 (HMM E-Value=8.1e-05) Length = 226 Score = 32.3 bits (70), Expect = 0.26 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Frame = +3 Query: 141 NFLKQNYCNLVVIFITAGKGIHMRVVEKGLLSITPWETLCTNAHVFIRYKWRT--FMVFL 314 NF K +L++++I A + +E GL S TP CT+ YK+RT F FL Sbjct: 129 NFTKAQK-SLLLLWIFAWMTFSVPFIEHGLRSTTPVTRSCTSMFTHGGYKFRTYYFPGFL 187 Query: 315 LVS*VGI 335 LV+ + + Sbjct: 188 LVTIISL 194 >SB_12896| Best HMM Match : Plasmodium_HRP (HMM E-Value=1.1) Length = 284 Score = 31.5 bits (68), Expect = 0.46 Identities = 15/53 (28%), Positives = 19/53 (35%) Frame = -1 Query: 329 YLAHQEEHHERPPFVPYEYMRIRTKRFPWGDGQKSLFHNPHVNALPSGYEDDH 171 Y H E P Y Y R T R P+ D + +H P +P H Sbjct: 174 YATHYAEQRPHDP-THYAYHRAYTGRIPYADHRGYRYHGPETRRMPQALHRPH 225 >SB_41317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 28.3 bits (60), Expect = 4.3 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +3 Query: 72 KRRKKIAIFLTFNNLKYMNVLQTNFLKQNYCNLVVIFITAGKGIHMRVVEKGLLS-ITPW 248 +RR + + + F NL+ + L ++Y N+ V F+T G H R + L S + Sbjct: 163 ERRLLMDLCIPFVNLEVFGCPKYQELHEHYSNVHVSFMT---GAHERACKHHLYSTFSDT 219 Query: 249 ETLCTNAHVFIRYKW 293 C A V++ KW Sbjct: 220 PKHCPKAEVYLFGKW 234 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 57 NFNPIKRRKKIAIFLTFNNLKYMNVLQTNFLKQNYCNLV 173 +F I+ RKK+ +F+ N L LQ + L ++C+ + Sbjct: 1034 SFVAIEHRKKVCLFMALNKLNNDVTLQGSNLSLSFCDSI 1072 >SB_34802| Best HMM Match : SBP (HMM E-Value=7.9) Length = 283 Score = 27.9 bits (59), Expect = 5.7 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +3 Query: 72 KRRKKIAIFLTFNNLKYMNVLQTNFLKQNYCNLVVIFITAGKGIHMRVVEKGLLS-ITPW 248 +RR + + + F NL+ + L ++Y N+ V F+T G H + L S + Sbjct: 139 ERRLLMGLCIPFVNLEVFGCPKYQELHEHYSNMHVSFMT---GAHEKACRHHLYSTFSDT 195 Query: 249 ETLCTNAHVFIRYKW 293 C A V++ KW Sbjct: 196 PKHCPKAEVYLFGKW 210 >SB_28914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1016 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 301 NVRHLYLMNTCAFVQSVSHG 242 +V HL +N C FV VSHG Sbjct: 821 HVAHLVQVNECYFVNQVSHG 840 >SB_19079| Best HMM Match : LCM (HMM E-Value=6.3e-37) Length = 420 Score = 27.5 bits (58), Expect = 7.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 233 QKSLFHNPHVNALPSGYEDD 174 Q +LF+ PH N LPSG+ + Sbjct: 131 QNNLFNIPHENELPSGFHSE 150 >SB_54058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 389 WKRMSFFVAFPAIALGMLNAYLAHQEEHHERPPFV 285 WK + F A+ + YL +E H +PPFV Sbjct: 13 WKFLDVFRKEIAVTVFQSRHYLEFEEAHQTQPPFV 47 >SB_48973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.1 bits (57), Expect = 9.9 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +3 Query: 72 KRRKKIAIFLTFNNLKYMNVLQTNFLKQNYCNLVVIFITAGKGIHMRVVEKGLLS-ITPW 248 +RR + + + F NL+ + L ++Y N+ V F+T G H + L S + Sbjct: 42 ERRLLMDLSIPFVNLEVFGCPKYQELHEHYSNMHVSFMT---GAHEKACRHHLYSTFSDT 98 Query: 249 ETLCTNAHVFIRYKW 293 C A V++ KW Sbjct: 99 PKHCPKAEVYLFGKW 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,115,807 Number of Sequences: 59808 Number of extensions: 305513 Number of successful extensions: 703 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -