BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a12r (542 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U12966-3|AAA20614.1| 128|Caenorhabditis elegans Temporarily ass... 69 2e-12 Z81093-2|CAB03146.1| 545|Caenorhabditis elegans Hypothetical pr... 28 3.8 >U12966-3|AAA20614.1| 128|Caenorhabditis elegans Temporarily assigned gene nameprotein 174 protein. Length = 128 Score = 68.9 bits (161), Expect = 2e-12 Identities = 31/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (2%) Frame = -1 Query: 389 WKRMSFFVAFPAIALGMLNAYLAHQEE-HHERPPFVPYEYMRIRTKRFPWGDGQKSLFHN 213 WK++ F + P +AL M A+ H++ HERP V Y ++ +R K FPW DG SLFHN Sbjct: 51 WKKIFFIASIPCLALTMYAAFKDHKKHMSHERPEHVEYAFLNVRNKPFPWSDGNHSLFHN 110 Query: 212 PHVNALPS-GYEDD 174 +P G+E D Sbjct: 111 KAEQFVPGVGFEAD 124 >Z81093-2|CAB03146.1| 545|Caenorhabditis elegans Hypothetical protein F58D2.1 protein. Length = 545 Score = 28.3 bits (60), Expect = 3.8 Identities = 10/37 (27%), Positives = 24/37 (64%) Frame = +3 Query: 66 PIKRRKKIAIFLTFNNLKYMNVLQTNFLKQNYCNLVV 176 PIK ++++ NNLK +++ +T F++++ N ++ Sbjct: 150 PIKSCEELSDLFNLNNLKAVDISETRFIRESNNNTIM 186 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,666,128 Number of Sequences: 27780 Number of extensions: 235195 Number of successful extensions: 557 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1091917214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -