BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a09f (536 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40070.1 68415.m04923 expressed protein 33 0.12 At1g77010.1 68414.m08968 pentatricopeptide (PPR) repeat-containi... 32 0.28 At4g24680.1 68417.m03533 expressed protein 30 1.1 At3g03450.1 68416.m00343 gibberellin response modulator, putativ... 30 1.1 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 29 1.5 At1g10880.1 68414.m01250 expressed protein contains Pfam profile... 29 1.5 At2g43610.1 68415.m05421 glycoside hydrolase family 19 protein s... 29 2.0 At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar... 29 2.0 At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note:... 29 2.0 At5g43310.1 68418.m05293 COP1-interacting protein-related contai... 29 2.6 At1g21440.1 68414.m02681 mutase family protein similar to carbox... 29 2.6 At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase f... 28 3.4 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 28 3.4 At4g08670.1 68417.m01428 protease inhibitor/seed storage/lipid t... 28 3.4 At3g28790.1 68416.m03593 expressed protein 28 3.4 At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identica... 28 3.4 At1g34000.2 68414.m04216 light stress-responsive one-helix prote... 28 4.5 At1g34000.1 68414.m04215 light stress-responsive one-helix prote... 28 4.5 At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldol... 28 4.5 At3g18500.1 68416.m02351 nocturnin-related contains weak similar... 27 6.0 At2g48160.1 68415.m06031 PWWP domain-containing protein 27 6.0 At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein si... 27 6.0 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 27 6.0 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 27 7.9 At4g18760.1 68417.m02772 leucine-rich repeat family protein cont... 27 7.9 At3g57660.1 68416.m06424 DNA-directed RNA polymerase family prot... 27 7.9 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 27 7.9 >At2g40070.1 68415.m04923 expressed protein Length = 607 Score = 33.1 bits (72), Expect = 0.12 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 5/87 (5%) Frame = +2 Query: 284 TRPWSRRLAQSVCTPRIPLVS-SASTGMSNPLTSSL-PWLCLPARTYPNPEMSAALAKST 457 T P S+ +++S R P+ S SA+T +NP S + P PA+ P P + AL+++ Sbjct: 303 TLPPSKTISRSSTPTRRPIASASAATTTANPTISQIKPSSPAPAKPMPTPSKNPALSRAA 362 Query: 458 ANLESN*AASTCPWCP---PTVSLRPP 529 + + PW P P SL P Sbjct: 363 SP-----TVRSRPWKPSDMPGFSLETP 384 >At1g77010.1 68414.m08968 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 695 Score = 31.9 bits (69), Expect = 0.28 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = -3 Query: 405 GRQSHGRDEVSGLDIPVDADETNGIRGVQTDCASLRDQGRVNYHHQTITDPDETDILEAA 226 G+Q H + + G++ D+ + + V C LR +Y + I +PD+ + Sbjct: 206 GKQIHAQILIGGVEC--DSKMNSSLVNVYAKCGDLR---MASYMLEQIREPDDHSLSALI 260 Query: 225 SGAEDPARVNEGTG 184 SG + RVNE G Sbjct: 261 SGYANCGRVNESRG 274 >At4g24680.1 68417.m03533 expressed protein Length = 1480 Score = 29.9 bits (64), Expect = 1.1 Identities = 30/91 (32%), Positives = 40/91 (43%), Gaps = 4/91 (4%) Frame = -1 Query: 503 GTTDTSKQLSCSPGSPS-TSPKPQTFPDSGRSSLAD--KATGEMKSVGWTSLLMLTRPMV 333 GT+ S + PGSPS S +P + R S AD KA SV W S +RP Sbjct: 63 GTSSLSPRTESGPGSPSHLSNRPSSGGSVTRPSTADSNKAHDSSSSVAWDS---NSRPSS 119 Query: 332 SEGCRRTALVSVT-RDGLITTTRP*RTQMKR 243 + G + SV + TRP +Q+ R Sbjct: 120 ASGVFPSNQPSVALQRPHSADTRPGSSQLSR 150 >At3g03450.1 68416.m00343 gibberellin response modulator, putative / gibberellin-responsive modulator, putative similar to GAI (GI:2569938), RGA1 (GB:AAC67333) and RGA2 (GI:2339980) [Arabidopsis thaliana]; possible involvement in nitrogen metabolism Length = 547 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 58 LALVQGRSTGVQSTNALVALGDKPYQVHLRIAVSTSGLLNTCAGS 192 + LV + TGV+ +ALVA + +Q +L +A + + T AGS Sbjct: 168 VVLVDSQETGVRLVHALVACAEAIHQENLNLADALVKRVGTLAGS 212 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +2 Query: 116 SETSPTRSIYASLF--RPVVCSTPAPVPSFTLAGS-SAP 223 S +S T S +S+F P + S+P+P P+FT A S SAP Sbjct: 162 SSSSSTSSSSSSIFPTNPHIYSSPSPPPTFTTATSDSAP 200 >At1g10880.1 68414.m01250 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 651 Score = 29.5 bits (63), Expect = 1.5 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -1 Query: 479 LSCSP-GSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSEGCRRTALV 303 LS +P SPS SP P P S S++AD + + W + + PM +E + A + Sbjct: 69 LSSNPLTSPSLSPPPSPSPRSSGSNIAD------EELMWRAAMAPRSPMKNETHPKVAFM 122 Query: 302 SVTR 291 +TR Sbjct: 123 FLTR 126 >At2g43610.1 68415.m05421 glycoside hydrolase family 19 protein similar to chitinase GI:17799 from [Brassica napus]; contains Pfam profiles PF00182: Chitinase class I, PF00187: Chitin recognition protein Length = 281 Score = 29.1 bits (62), Expect = 2.0 Identities = 28/109 (25%), Positives = 38/109 (34%) Frame = -1 Query: 533 SLVASRRPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLL 354 ++ SR GTT C G ++ PKP P SG L G + SV + Sbjct: 39 NMCCSRWGYCGTTKAYCGTGCQSGPCNSKPKPTPTP-SGSGGLNAGPRGTIASVITPAFF 97 Query: 353 MLTRPMVSEGCRRTALVSVTRDGLITTTRP*RTQMKRTSWRQLAALRTQ 207 V GC A TR I + R++AA+ Q Sbjct: 98 NSIMSKVGSGC--PAKGFYTRQAFIAAAESFAAYKGTVAKREIAAMLAQ 144 >At1g21730.1 68414.m02720 kinesin-related protein (MKRP1) Similar to gb|U06698 neuronal kinesin heavy chain from Homo sapiens and contains a PF|00225 Kinesin motor domain. EST gb|AA042507 comes from this gene; identical to cDNA MKRP1 mRNA for kinesin-related protein, GI:16902291, kinesin-related protein [Arabidopsis thaliana] GI:16902292 Length = 890 Score = 29.1 bits (62), Expect = 2.0 Identities = 18/42 (42%), Positives = 25/42 (59%) Frame = +2 Query: 335 PLVSSASTGMSNPLTSSLPWLCLPARTYPNPEMSAALAKSTA 460 P S+S ++P+TSS P L R+ P+P S+A A STA Sbjct: 29 PETPSSSHFSASPVTSSSPLL----RSSPSPSTSSAAASSTA 66 >At1g08140.1 68414.m00896 cation/hydrogen exchanger (CHX6a) Note: CHX6a and CHX6b were originally 1 gene but were split pased on alignments with other family members; may be a pseudogene and requires futher investigation; monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 818 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 297 DQGRVNYHHQTITDPDETD-ILEAASGAEDPARVNEGTGAGVEQTTG 160 + +V Y + ++D ET IL A + D V G+G G E T+G Sbjct: 724 NDAKVTYIDKAVSDGSETSRILRAMANDYDLFIVGSGSGIGTEATSG 770 >At5g43310.1 68418.m05293 COP1-interacting protein-related contains similarity to COP1-Interacting Protein 7 (CIP7) [Arabidopsis thaliana] GI:3327868 Length = 1237 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -1 Query: 437 QTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSEGCRRTALVS 300 Q FP +G+ S K+TG M + + L R ++ G R T +S Sbjct: 836 QKFPKNGKLSTVSKSTGNMLTRSISPLPPAKRESIATGIRLTRSIS 881 >At1g21440.1 68414.m02681 mutase family protein similar to carboxyvinyl-carboxyphosphonate phosphorylmutase GB:O49290 from [Arabidopsis thaliana]; similar to carboxyphosphonoenolpyruvate mutase (GI:47149) [Streptomyces hygroscopicus]; contains Prosite PS00161: Isocitrate lyase signature Length = 336 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +2 Query: 281 LTRPWSRRLAQSVCT--PRIPLVSSASTGMSNPL 376 +T P A+SVC P+IP+++ A TG N L Sbjct: 95 ITPPEMAATARSVCAAAPKIPIIADADTGGGNAL 128 >At4g31670.1 68417.m04497 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 631 Score = 28.3 bits (60), Expect = 3.4 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = -1 Query: 536 SSLVASRRPSAGTTDTSKQLSCSPG-SPSTSPKPQTFPDSGRSSLADKATGEMKSV 372 SS+V + + T T + C SPS SP P P S LA + E++ + Sbjct: 508 SSMVGAIESRSSTHATIEDPVCEQSPSPSPSPSPSPSPSPSPSVLASECCSEVERI 563 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 28.3 bits (60), Expect = 3.4 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 83 PVCKVPTPWLPSETSPTRSIYA-SLFRPVVCSTPAPVPSFT 202 P KVPTP +PS PT S+ + S+ P V S P P+ T Sbjct: 45 PSPKVPTPSVPSPYVPTPSVPSPSVPTPSVPSPSVPSPNPT 85 >At4g08670.1 68417.m01428 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 208 Score = 28.3 bits (60), Expect = 3.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 509 SAGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEM 381 S TT + +S S G+P+TSP P++ +S + T M Sbjct: 130 SGATTPGASPVSPSAGAPTTSPSAAKSPETSATSPSSDETPSM 172 >At3g28790.1 68416.m03593 expressed protein Length = 608 Score = 28.3 bits (60), Expect = 3.4 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -1 Query: 521 SRRPSAGTT--DTSKQLSCSP-GSPSTSPKPQTFPDSGRSS 408 + + S+G T DT+ S SP GSPS SP P T D SS Sbjct: 355 TNKGSSGDTYKDTTGTSSGSPSGSPSGSPTPSTSTDGKASS 395 >At2g22470.1 68415.m02664 arabinogalactan-protein (AGP2) identical to gi|3883122|gb|AAC77824; supported by cDNA gi|3883121|gb|AF082299 Length = 131 Score = 28.3 bits (60), Expect = 3.4 Identities = 20/49 (40%), Positives = 23/49 (46%) Frame = +2 Query: 77 AAPVCKVPTPWLPSETSPTRSIYASLFRPVVCSTPAPVPSFTLAGSSAP 223 A+P V P TSPT S AS P PAP PS L +S+P Sbjct: 50 ASPPVPVNEPTPAPTTSPTTSPVAS---PPQTDAPAPGPSAGLTPTSSP 95 >At1g34000.2 68414.m04216 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 145 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 518 RRPSAGTTDTSKQLSCSPGSPSTSPKPQTFP 426 RRPSA T Q P PS+SP P P Sbjct: 51 RRPSAPPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g34000.1 68414.m04215 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 172 Score = 27.9 bits (59), Expect = 4.5 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 518 RRPSAGTTDTSKQLSCSPGSPSTSPKPQTFP 426 RRPSA T Q P PS+SP P P Sbjct: 51 RRPSAPPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g22410.1 68414.m02802 2-dehydro-3-deoxyphosphoheptonate aldolase, putative / 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase, putative / DAHP synthetase, putative similar to 3-deoxy-D-arabino-heptulosonate 7-phosphate GI:170224 from [Nicotiana tabacum], SP|P21357 from Solanum tuberosum; contains Pfam Class-II DAHP synthetase family domain PF01474 Length = 527 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 281 LTRPWSRRLAQSVCTPRIPLVSSASTGMSNPLTSSLP 391 ++RP S R++ P+ P SSAS + P T + P Sbjct: 29 VSRPTSFRISAVQTDPKTPAASSASAATTTPATLTKP 65 >At3g18500.1 68416.m02351 nocturnin-related contains weak similarity to Nocturnin (CCR4 protein homolog) (Swiss-Prot:O35710) [Mus musculus] Length = 262 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 160 TSGLLNTCAGSLIHSRWVLSAASCLQDVRFIWVRYGLVVV 279 T L + G ++HS LS+ S + R+ WV + ++ Sbjct: 218 TLSLASLVCGIMLHSLLFLSSGSLISQERYCWVTFTCFII 257 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 27.5 bits (58), Expect = 6.0 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = -1 Query: 515 RPSAGTTDTSKQLSCSPGSPSTSPKPQTFPDS--GRSSLADKATGEMKSVGWTSL 357 RP GT+ LS SP PS+SP P P S G ++ D ++ G+ ++ Sbjct: 1123 RPVFGTSHQHMSLS-SPPLPSSSPPPPPAPPSQQGECAMPDSYLNGFENGGYRNV 1176 >At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein similar to beta-amylase GI:13560977 from [Castanea crenata] Length = 691 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/40 (27%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 87 CAKYQRPGCPRRQA--LPGPSTHRCFDQWSAQHLRRFPHS 200 C + + P CP + PG +C+D++ ++ LR+ S Sbjct: 420 CGELRYPSCPIKHGWRYPGVGEFQCYDKYLSKSLRKAAES 459 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 98 PTPWLPSETSPTRSIYASLFRP-VVCSTPAPVPSFTLAGSSAP 223 P P++ S P +Y S P V +P P PS++ + SS P Sbjct: 432 PPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPPSYSYSYSSPP 474 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 38 LLYYCAVLLWYRGAAPVCKVPTPWLPSETSPTRSIYASLFRPVVCS 175 + ++ ++LL + A V K T W SP I +SLF + C+ Sbjct: 9 ITFFLSLLLRFSSAQTVVKA-TYWFAESESPLAQIDSSLFTHLFCA 53 >At4g18760.1 68417.m02772 leucine-rich repeat family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611 Length = 431 Score = 27.1 bits (57), Expect = 7.9 Identities = 22/77 (28%), Positives = 31/77 (40%) Frame = -1 Query: 506 AGTTDTSKQLSCSPGSPSTSPKPQTFPDSGRSSLADKATGEMKSVGWTSLLMLTRPMVSE 327 + T + LS +P SP+TSP P P S S L K ++S L P V + Sbjct: 16 SATISAAPSLSPTP-SPTTSPIPPHKPSSSSSPLDPKQLKALES--------LNIPTVKD 66 Query: 326 GCRRTALVSVTRDGLIT 276 C T ++T Sbjct: 67 PCNHRPTTKSTSSSVVT 83 >At3g57660.1 68416.m06424 DNA-directed RNA polymerase family protein similar to SP|O35134 DNA-directed RNA polymerase I largest subunit (EC 2.7.7.6) (RNA polymerase I 194 kDa subunit) (RPA194) {Mus musculus}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1670 Score = 27.1 bits (57), Expect = 7.9 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Frame = -3 Query: 411 LAGRQSHGRDEVSGLDIPVDAD---ETNGIRGVQTDCASLRDQGRVNYHHQTITDPDETD 241 +AG ++ D VSG D D E + + +D + Q ++ ++ DET+ Sbjct: 1321 IAGNETDNDDSVSGKQNEDDGDDDGEGTEVDDLGSDAQKQKKQETDEMDYEENSE-DETN 1379 Query: 240 ILEAASGAEDPA--RVNEGTGAGVEQT 166 + SG EDP NE T E T Sbjct: 1380 EPSSISGVEDPEMDSENEDTEVSKEDT 1406 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 470 SPGSPSTSPKPQTFPDS 420 SP SP++SPKP++ DS Sbjct: 127 SPQSPASSPKPESLADS 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,172,023 Number of Sequences: 28952 Number of extensions: 318985 Number of successful extensions: 1229 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 993966856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -