BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a07f (647 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 36 3e-04 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 0.63 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 25 0.83 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 25 0.83 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 25 0.83 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 25 0.83 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 1.9 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 1.9 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 3.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 3.4 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 4.4 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 22 5.9 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.9 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 5.9 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 7.8 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 7.8 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 35.9 bits (79), Expect = 3e-04 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +2 Query: 182 TRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHC 325 +RIVGG+ P +AG+ G ICGA++++ +TAAHC Sbjct: 159 SRIVGGTNTGINEFPMMAGIKRTYEPGM--ICGATIISKRYVLTAAHC 204 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.0 bits (52), Expect = 0.63 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 260 HSSVRSQVQQDGGEHQRWRQNHPQSWYRRSQR 165 HSS ++Q QQ + Q+ +Q PQ ++ Q+ Sbjct: 1495 HSSQKTQQQQPQQQQQQQQQQQPQQQSQQPQQ 1526 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -2 Query: 403 PGAS---GEDVSCAKSEGELTSLGSPG 332 PG S GE S A ++G T+ SPG Sbjct: 893 PGCSSKNGEPTSAAFAQGFATAASSPG 919 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.6 bits (51), Expect = 0.83 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 635 GGSLGVFVGCWLP 597 G +GVFV CWLP Sbjct: 330 GVIMGVFVVCWLP 342 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 24.6 bits (51), Expect = 0.83 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 635 GGSLGVFVGCWLP 597 G +GVFV CWLP Sbjct: 330 GVIMGVFVVCWLP 342 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 24.6 bits (51), Expect = 0.83 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +1 Query: 232 CWTCDRTDEWQNFH 273 CW CD+ +E++ H Sbjct: 467 CWVCDQCEEYEYVH 480 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 24.6 bits (51), Expect = 0.83 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 635 GGSLGVFVGCWLP 597 G +GVFV CWLP Sbjct: 330 GVIMGVFVVCWLP 342 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 626 LGVFVGCWLP 597 LGVF+ CWLP Sbjct: 625 LGVFLICWLP 634 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 1.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 626 LGVFVGCWLP 597 +GVF+ CWLP Sbjct: 341 MGVFIICWLP 350 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 493 LHQQHPAHQPSQWKQQ 540 +H QHP QP Q + Q Sbjct: 172 MHTQHPHMQPQQGQHQ 187 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 3.4 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +1 Query: 232 CWTCDRTDEWQ 264 CW CD+ +E++ Sbjct: 557 CWVCDQCEEYE 567 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 626 LGVFVGCWLP 597 +G FV CWLP Sbjct: 312 VGGFVACWLP 321 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.8 bits (44), Expect = 5.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 635 GGSLGVFVGCWLP 597 G +GVF+ CW+P Sbjct: 275 GVIMGVFLICWVP 287 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 323 CWRTRRAQARQFTLALGTANI 385 CW TR+ Q +GT+N+ Sbjct: 459 CWDTRKEYIPQNLGVIGTSNL 479 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 5.9 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 38 WLLPVYRFPRVE 3 WL P+Y+ P+V+ Sbjct: 70 WLSPIYKSPQVD 81 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 434 SYNMDTLHNDVAIINHNHVGFTNN 505 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 434 SYNMDTLHNDVAIINHNHVGFTNN 505 S + +T+HN+ N+N+ + NN Sbjct: 83 SLSNNTIHNNNYKYNYNNNNYNNN 106 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,823 Number of Sequences: 438 Number of extensions: 2963 Number of successful extensions: 22 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -