BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a06r (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32751| Best HMM Match : Pentapeptide_2 (HMM E-Value=1.8) 31 1.1 SB_33579| Best HMM Match : Laminin_G_2 (HMM E-Value=3.2e-34) 29 2.6 SB_33399| Best HMM Match : Ank (HMM E-Value=0) 29 3.4 SB_53822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_17765| Best HMM Match : 7tm_1 (HMM E-Value=7.6e-16) 29 4.5 SB_30999| Best HMM Match : DUF1233 (HMM E-Value=7.1) 28 5.9 SB_48953| Best HMM Match : NIF3 (HMM E-Value=1.7e-12) 28 5.9 >SB_32751| Best HMM Match : Pentapeptide_2 (HMM E-Value=1.8) Length = 127 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 374 GFKDLGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNISIG-IGF 249 G+ D+GY+ + G N Y G+N IG + + YN+I IG+ Sbjct: 47 GYNDIGYNDI-GYNDIGYNDIGYNDIGYNDIGYNDIGYNDIGY 88 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 374 GFKDLGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNISIG-IGF 249 G+ D+GY+ + G N Y G+N IG + + YN+I IG+ Sbjct: 57 GYNDIGYNDI-GYNDIGYNDIGYNDIGYNDIGYNDIGYNDIGY 98 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 374 GFKDLGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNISIG-IGF 249 G+ D+GY+ + G N Y G+N IG + + YN+I IG+ Sbjct: 67 GYNDIGYNDI-GYNDIGYNDIGYNDIGYNDIGYNDIGYNDIGY 108 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 374 GFKDLGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNISIG-IGF 249 G+ D+GY+ + G N Y G+N IG + + YN+I IG+ Sbjct: 77 GYNDIGYNDI-GYNDIGYNDIGYNDIGYNDIGYNDIGYNDIGY 118 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 374 GFKDLGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNI 267 G+ D+GY+ + G N Y G+N IG + + YN+I Sbjct: 87 GYNDIGYNDI-GYNDIGYNDIGYNDIGYNDIGYNDI 121 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -2 Query: 374 GFKDLGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNI 267 G+ D+GY+ + G N Y G+N IG + + YN+I Sbjct: 92 GYNDIGYNDI-GYNDIGYNDIGYNDIGYNDIGYNDI 126 Score = 28.3 bits (60), Expect = 5.9 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = -2 Query: 428 EECLLSVNSLRQHHMLLAGFKDLGYSFVA----GGNGKIYEGAGWNHIGAHTLHYNNISI 261 EE +S+ + H+ + + D+GY+ + G N Y G+N IG + + YN+I Sbjct: 15 EERYISIGHISIGHISIE-YNDIGYNDIEYNDIGYNDIGYNDIGYNDIGYNDIGYNDIGY 73 Query: 260 G-IGF 249 IG+ Sbjct: 74 NDIGY 78 >SB_33579| Best HMM Match : Laminin_G_2 (HMM E-Value=3.2e-34) Length = 1071 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 Query: 379 WLGSRTWAIHSWLEATEKFMKERDGTISVLTHCTTI 272 W+ SR+ ++HSW++ T K M + + + T C TI Sbjct: 534 WI-SRSGSLHSWVDGTIKNMDQPESQQTSQTDCDTI 568 >SB_33399| Best HMM Match : Ank (HMM E-Value=0) Length = 1416 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +1 Query: 409 TLSKHSSSVKQ--SLDTVCCITTKSIGLFRGCLRRDSVPLHSVMGISP 546 T+S SS+ Q ++D++ + + IG R C R + PL S+ GISP Sbjct: 1245 TISPIGSSLAQCSTVDSMDKPSLRPIGTERACRRATASPLPSMPGISP 1292 >SB_53822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 300 MVPSRSFINFSVASSHE*IAQVLEPSQKHMMLS 398 + PS +F +F + HE + ++ P+ KH+ LS Sbjct: 31 LYPSINFESFHIPFDHEEVKDLIPPTAKHVFLS 63 >SB_17765| Best HMM Match : 7tm_1 (HMM E-Value=7.6e-16) Length = 424 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 362 LGYSFVAGGNGKIYEGAGWNHIGAHTLHYNNISIGIGFI 246 +G+S G K+ G W A TL YN + + +GF+ Sbjct: 159 VGWSKFVPGAAKVSCGPDWETQNASTLSYNIVLLIVGFV 197 >SB_30999| Best HMM Match : DUF1233 (HMM E-Value=7.1) Length = 142 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -3 Query: 379 WLGSRTWAIHSWLEATEKFMKERDGTISVLTHCTTI 272 W+ SR+ ++HSW++ T K M + + + T C T+ Sbjct: 51 WI-SRSGSLHSWVDGTIKNMDQPESQQTSQTDCDTM 85 >SB_48953| Best HMM Match : NIF3 (HMM E-Value=1.7e-12) Length = 288 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -2 Query: 326 IYEGAGWNHIGAHTLHYNNISIGIGFIGDFREKLPTQQALQAVQDFLACG 177 IYE + + H N IG+G IG+F + + L V++ + CG Sbjct: 144 IYEEVAYEIYSLNNKHQN---IGLGMIGEFETPMNETEFLAFVKNKMQCG 190 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,621,192 Number of Sequences: 59808 Number of extensions: 457006 Number of successful extensions: 1451 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1299 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1445 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -