BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a06f (625 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18500.1 68415.m02156 ovate family protein 69% similar to ova... 30 1.4 At3g48560.1 68416.m05302 acetolactate synthase, chloroplast / ac... 29 2.5 At3g15510.1 68416.m01966 no apical meristem (NAM) family protein... 29 2.5 At2g11345.1 68415.m01217 hypothetical protein similar to At3g426... 28 4.4 At5g52100.1 68418.m06467 dihydrodipicolinate reductase family pr... 28 5.8 At2g04100.1 68415.m00393 MATE efflux family protein similar to r... 28 5.8 At1g58090.1 68414.m06583 F-box family protein contains F-box dom... 28 5.8 At2g04040.1 68415.m00385 MATE efflux family protein contains Pfa... 27 7.7 >At2g18500.1 68415.m02156 ovate family protein 69% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 315 Score = 29.9 bits (64), Expect = 1.4 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 242 CLLSVNSLRQHHMLLAGFKDLGYSFVAGGNG 334 C LS+N+ R H ++ F ++ + +GG+G Sbjct: 266 CFLSLNAKRHHRAIVRAFSEIWVALFSGGSG 296 >At3g48560.1 68416.m05302 acetolactate synthase, chloroplast / acetohydroxy-acid synthase (ALS) nearly identical to SP|P17597 Acetolactate synthase, chloroplast precursor (EC 2.2.1.6, formerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS) {Arabidopsis thaliana} Length = 670 Score = 29.1 bits (62), Expect = 2.5 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = -2 Query: 333 PLPPATNE*PKSLNPARSI*CCRREFTLSKHSSSVKQSLDTVCCITT 193 PLP + P SLNP +S RR S SS+ L+T +TT Sbjct: 28 PLPISRFSLPFSLNPNKSSSSSRRRGIKSSSPSSISAVLNTTTNVTT 74 >At3g15510.1 68416.m01966 no apical meristem (NAM) family protein (NAC2) identical to AtNAC2 [Arabidopsis thaliana] GI:12060426; contains Pfam PF02365: No apical meristem (NAM) domain; similar to jasmonic acid 2 GB:AAF04915 from [Lycopersicon esculentum] Length = 364 Score = 29.1 bits (62), Expect = 2.5 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +2 Query: 257 NSLRQHHMLLAGFKDLGYS-FVAGGNGKIYEGAGW-NHIGAHTLHYNNISIGIG 412 N R + F GY F GGN IY+G G N+IG ++ ++N + +G Sbjct: 220 NVSRSMNFFPGKFSGGGYGIFSDGGNTSIYDGGGMINNIGTDSVDHDNNADVVG 273 >At2g11345.1 68415.m01217 hypothetical protein similar to At3g42690, At4g04130 Length = 138 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 422 DFREKLPTQQALQAVQDFLACGVENNLLTE 511 +FR+KLPT+ ++A QD V N L E Sbjct: 29 EFRDKLPTESEVEAHQDPACLSVWNRLFGE 58 >At5g52100.1 68418.m06467 dihydrodipicolinate reductase family protein weak similarity to dihydrodipicolinate reductase [Corynebacterium glutamicum] GI:311768; contains Pfam profiles PF01113: Dihydrodipicolinate reductase N-terminus, PF05173: Dihydrodipicolinate reductase C-terminus Length = 298 Score = 27.9 bits (59), Expect = 5.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 105 SRPNAAKFPSPNGVARSHVVNNL 173 SRPNAA PSP + ++ ++NL Sbjct: 189 SRPNAADLPSPEAIQIANNISNL 211 >At2g04100.1 68415.m00393 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 483 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 278 MLLAGFKDLGYSFVAGGNGKIYEGAGWNHIGA 373 +L F G+S V GG + G+GW HIGA Sbjct: 379 LLCISFLVDGFSAVLGG---VARGSGWQHIGA 407 >At1g58090.1 68414.m06583 F-box family protein contains F-box domain Pfam:PF00646 Length = 371 Score = 27.9 bits (59), Expect = 5.8 Identities = 23/85 (27%), Positives = 33/85 (38%), Gaps = 8/85 (9%) Frame = +2 Query: 206 HTVSNDCFTDEECLLSVNSLRQHHMLLAGFKDLG--------YSFVAGGNGKIYEGAGWN 361 +++S D DE + V LR H+ G+ G YSF+ GG G ++ W Sbjct: 63 YSISVD-LKDENPTIKVRDLRFDHLSCRGYHLYGICDGNFFMYSFLNGGGGVVWNPLFWR 121 Query: 362 HIGAHTLHYNNISIGIGFIGDFREK 436 N IG+ G EK Sbjct: 122 QTKWIAKAENTCGKAIGYDGSRPEK 146 >At2g04040.1 68415.m00385 MATE efflux family protein contains Pfam profile: PF01554 uncharacterized membrane protein family Length = 476 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 314 FVAGGNGKIYEGAGWNHIGA--HTLHYNNISIGIGFIGDFREKL 439 F A NG + G+GW HIGA +T+ Y + +G F +L Sbjct: 386 FTAVLNG-VARGSGWQHIGAWNNTVSYYLVGAPVGIYLAFSREL 428 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,238,527 Number of Sequences: 28952 Number of extensions: 311475 Number of successful extensions: 766 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 766 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -