BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a04r (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl... 32 0.46 At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl... 32 0.46 At1g30450.3 68414.m03722 cation-chloride cotransporter, putative... 30 1.4 At1g30450.2 68414.m03721 cation-chloride cotransporter, putative... 30 1.4 At1g30450.1 68414.m03720 cation-chloride cotransporter, putative... 30 1.4 At4g16080.1 68417.m02438 hypothetical protein contains Pfam prof... 29 4.3 At5g25170.1 68418.m02984 expressed protein 28 5.7 At2g01050.1 68415.m00010 hypothetical protein 28 5.7 At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containi... 28 5.7 At4g11530.1 68417.m01850 protein kinase family protein contains ... 28 7.6 At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like... 28 7.6 At4g33600.1 68417.m04773 expressed protein 27 10.0 >At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 31.9 bits (69), Expect = 0.46 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +2 Query: 332 NTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILV 436 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly identical to 3-phosphoserine phosphatase GI:3759177 from [Arabidopsis thaliana] Length = 295 Score = 31.9 bits (69), Expect = 0.46 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +2 Query: 332 NTLGYYDTLLDNSTLLDVWAEVDGMCYSYDAHILV 436 +TLG+ ++ + +LD+W V+ +C+ D+ + V Sbjct: 62 STLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCV 96 >At1g30450.3 68414.m03722 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 577 LKGSGSW*EQYQRTVGTIDSRWV 645 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At1g30450.2 68414.m03721 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 577 LKGSGSW*EQYQRTVGTIDSRWV 645 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At1g30450.1 68414.m03720 cation-chloride cotransporter, putative similar to cation-chloride co-transporter GB:AAC49874 GI:2582381 from [Nicotiana tabacum], Cation-Chloride Cotransporter (CCC) Family Member, PMID:11500563 Length = 975 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 577 LKGSGSW*EQYQRTVGTIDSRWV 645 +KG W +YQR GTID W+ Sbjct: 767 IKGLDEWPNEYQRQYGTIDLYWI 789 >At4g16080.1 68417.m02438 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 379 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 213 PLYCSLQFSLLVTMSSSLWRLPSDTL 290 P Y L FS+LVT +SLW L D + Sbjct: 212 PQYHELNFSILVTGHTSLWSLLQDNV 237 >At5g25170.1 68418.m02984 expressed protein Length = 218 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 188 QILRRFGPGWWPRLRQY*LGCPCLLP 111 Q+ RR P W RL ++ L C C+LP Sbjct: 127 QLTRRSIPSWVNRLARFGLFCNCVLP 152 >At2g01050.1 68415.m00010 hypothetical protein Length = 515 Score = 28.3 bits (60), Expect = 5.7 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 5/90 (5%) Frame = +2 Query: 206 IMTLVLFPAVFFVGHNEFELVEVAVRYTAALNGSSPSEQINKNTL-----GYYDTLLDNS 370 +MT++ P FF+ FEL E Y AAL G P + L +D L D+ Sbjct: 108 VMTVMDLPRQFFM--IRFELEE---EYMAALTGG-PWRVLGNYLLVQDWSSRFDPLRDDI 161 Query: 371 TLLDVWAEVDGMCYSYDAHILVVILLREFG 460 VW + + Y+Y L++ + R G Sbjct: 162 VTTPVWVRLSNIPYNYYHRCLLMEIARGLG 191 >At1g62260.1 68414.m07024 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 656 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 142 NTDLGAPAFFQNALVGIVSFGKSNANDIYPVVLTSIS 32 N +G AF NA + FG +N IYP +T +S Sbjct: 479 NAMIGGYAFHGNASEALNLFGSMKSNGIYPSHITFVS 515 >At4g11530.1 68417.m01850 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 931 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = -1 Query: 640 ILNQWFQQCAGIVLTNYHYLSTATCFHGEF-----YDPAYRRIIA 521 +LN F L + Y+ST TCF+G F YD RRI++ Sbjct: 2 MLNTLFLPIFLFFLITFDYVSTQTCFNGYFKPNGTYDLNRRRILS 46 >At1g49740.1 68414.m05578 expressed protein similar to MAP3K-like protein kinase GB:CAB16796 GI:4006878 from [Arabidopsis thaliana] Length = 359 Score = 27.9 bits (59), Expect = 7.6 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 7/77 (9%) Frame = +2 Query: 248 HNEF-ELVEVAVRYTAAL----NGSSPSEQINKNTLGYYDTLLDNSTLLDVWA--EVDGM 406 HN F L EV+ +A L S + Q+N G+ + D D+W DG Sbjct: 84 HNSFARLGEVSRTGSAILAPTNQQDSITSQLNNGVRGFMLDMYDFQN--DIWLCHSFDGT 141 Query: 407 CYSYDAHILVVILLREF 457 C+++ A + +LREF Sbjct: 142 CFNFTAFQPAINILREF 158 >At4g33600.1 68417.m04773 expressed protein Length = 453 Score = 27.5 bits (58), Expect = 10.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 638 LESMVPTVRWYCSHQLPLPFNCYLFPWRILR 546 L +MVP V W HQ P L+ W LR Sbjct: 183 LSAMVPFVAWSLRHQCENPQRWVLYHWGELR 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,893,334 Number of Sequences: 28952 Number of extensions: 413537 Number of successful extensions: 1087 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1087 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -