BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a03r (563 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38780| Best HMM Match : Astacin (HMM E-Value=0) 44 1e-04 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 40 0.001 SB_55169| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 40 0.001 SB_47250| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_44513| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-08) 40 0.001 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 40 0.001 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 40 0.001 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 40 0.001 SB_16130| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 40 0.001 SB_6798| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_5933| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_2170| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 40 0.001 SB_54653| Best HMM Match : Peptidase_M24 (HMM E-Value=0.93) 40 0.001 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_42594| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_40440| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_39589| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_37146| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_36046| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 40 0.001 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 40 0.001 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_27212| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.001 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 40 0.001 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_43612| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 40 0.002 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.006 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.006 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 38 0.006 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 38 0.006 SB_23673| Best HMM Match : DUF855 (HMM E-Value=0.52) 38 0.006 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 38 0.007 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 38 0.007 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 38 0.007 SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.010 SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) 37 0.010 SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) 37 0.010 SB_49943| Best HMM Match : zf-nanos (HMM E-Value=9.2) 36 0.017 SB_16378| Best HMM Match : DCX (HMM E-Value=0.7) 36 0.017 SB_22340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) 36 0.030 SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.040 SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.040 SB_47792| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) 35 0.053 SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) 35 0.053 SB_13171| Best HMM Match : AT_hook (HMM E-Value=6.4) 35 0.053 SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 35 0.053 SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 34 0.070 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.092 SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 33 0.12 SB_10620| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 33 0.12 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) 33 0.16 SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) 33 0.21 SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_16201| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.21 SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.21 SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_11676| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_9839| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 32 0.28 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 32 0.28 SB_46411| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.28 SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.28 SB_21570| Best HMM Match : AT_hook (HMM E-Value=2) 32 0.28 SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.37 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 32 0.37 SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 32 0.37 SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_13125| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.37 SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) 32 0.37 SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) 32 0.37 SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) 32 0.37 SB_9256| Best HMM Match : PsiB (HMM E-Value=4.9) 32 0.37 SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) 32 0.37 SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) 32 0.37 SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.49 SB_12469| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 31 0.49 SB_52811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_59249| Best HMM Match : zf-C2H2 (HMM E-Value=0.016) 31 0.86 SB_54320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) 31 0.86 SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 31 0.86 SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) 31 0.86 SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 31 0.86 SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_35729| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) 31 0.86 SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 1.1 SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) 30 1.1 SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 1.1 SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 1.1 SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 1.1 SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) 30 1.1 SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034) 30 1.1 SB_48322| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 30 1.5 SB_6981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) 29 2.0 SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) 29 2.0 SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 2.0 SB_57774| Best HMM Match : GASA (HMM E-Value=7.6) 29 2.6 SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) 29 2.6 SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5) 29 3.5 SB_9819| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_24313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_20793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_37327| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 4.6 SB_8491| Best HMM Match : LicD (HMM E-Value=0.0094) 28 6.1 SB_26581| Best HMM Match : SspP (HMM E-Value=2.7) 27 8.0 SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2) 27 8.0 SB_3857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) 27 8.0 >SB_38780| Best HMM Match : Astacin (HMM E-Value=0) Length = 1153 Score = 43.6 bits (98), Expect = 1e-04 Identities = 35/130 (26%), Positives = 59/130 (45%), Gaps = 7/130 (5%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 533 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 592 Query: 246 HWKSAKLIFPKAGDNAPFWALRAKRGAVRDLFL*SSGSLTVTSQM-VHSVNIVPSKALI* 422 W+S +G+ R +R ++ S+ S T T + VH +++ S A + Sbjct: 593 RWRSECAAALNSGELKREAEERRQRRKAFEIRTGSNPSPTATPKAPVHPIHLRASTAQVF 652 Query: 423 SQSKSSEENR 452 ++ + R Sbjct: 653 LMNEGKDRKR 662 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 41.5 bits (93), Expect = 5e-04 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTR----WTDDLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R W D++ W ++A DRS Sbjct: 279 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSWQRDMLAIGLDVDNWEELAEDRS 338 Query: 246 HWKS 257 W+S Sbjct: 339 RWRS 342 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 241 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 300 Query: 246 HWKS 257 W+S Sbjct: 301 RWRS 304 >SB_55169| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 6 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 65 Query: 246 HWKS 257 W+S Sbjct: 66 RWRS 69 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 127 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 186 Query: 246 HWKS 257 W+S Sbjct: 187 RWRS 190 >SB_47250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 6 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 65 Query: 246 HWKS 257 W+S Sbjct: 66 RWRS 69 >SB_44513| Best HMM Match : Acetyltransf_1 (HMM E-Value=2.7e-08) Length = 573 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 6 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 65 Query: 246 HWKS 257 W+S Sbjct: 66 RWRS 69 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 567 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 626 Query: 246 HWKS 257 W+S Sbjct: 627 RWRS 630 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 399 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 458 Query: 246 HWKS 257 W+S Sbjct: 459 RWRS 462 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 847 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 906 Query: 246 HWKS 257 W+S Sbjct: 907 RWRS 910 >SB_16130| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 6 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 65 Query: 246 HWKS 257 W+S Sbjct: 66 RWRS 69 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 157 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 216 Query: 246 HWKS 257 W+S Sbjct: 217 RWRS 220 >SB_12029| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 192 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 61 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 120 Query: 246 HWKS 257 W+S Sbjct: 121 RWRS 124 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 530 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 589 Query: 246 HWKS 257 W+S Sbjct: 590 RWRS 593 >SB_6798| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 318 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 187 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 246 Query: 246 HWKS 257 W+S Sbjct: 247 RWRS 250 >SB_5933| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 43 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 102 Query: 246 HWKS 257 W+S Sbjct: 103 RWRS 106 >SB_2170| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 43 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 102 Query: 246 HWKS 257 W+S Sbjct: 103 RWRS 106 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 95 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 154 Query: 246 HWKS 257 W+S Sbjct: 155 RWRS 158 >SB_54653| Best HMM Match : Peptidase_M24 (HMM E-Value=0.93) Length = 1104 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 779 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 838 Query: 246 HWKS 257 W+S Sbjct: 839 RWRS 842 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 95 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 154 Query: 246 HWKS 257 W+S Sbjct: 155 RWRS 158 >SB_42594| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 186 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 55 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 114 Query: 246 HWKS 257 W+S Sbjct: 115 RWRS 118 >SB_40440| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 137 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 6 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 65 Query: 246 HWKS 257 W+S Sbjct: 66 RWRS 69 >SB_39589| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 43 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 102 Query: 246 HWKS 257 W+S Sbjct: 103 RWRS 106 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 211 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 270 Query: 246 HWKS 257 W+S Sbjct: 271 RWRS 274 >SB_37146| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 43 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 102 Query: 246 HWKS 257 W+S Sbjct: 103 RWRS 106 >SB_36046| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 43 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 102 Query: 246 HWKS 257 W+S Sbjct: 103 RWRS 106 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 176 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 235 Query: 246 HWKS 257 W+S Sbjct: 236 RWRS 239 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 95 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 154 Query: 246 HWKS 257 W+S Sbjct: 155 RWRS 158 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 211 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 270 Query: 246 HWKS 257 W+S Sbjct: 271 RWRS 274 >SB_27212| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 256 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 125 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 184 Query: 246 HWKS 257 W+S Sbjct: 185 RWRS 188 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 285 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 344 Query: 246 HWKS 257 W+S Sbjct: 345 RWRS 348 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 228 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 287 Query: 246 HWKS 257 W+S Sbjct: 288 RWRS 291 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 95 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 154 Query: 246 HWKS 257 W+S Sbjct: 155 RWRS 158 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 2487 GHVCRMENGRIPKDLLYGELVHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAKDRS 2546 Query: 246 HWKS 257 W+S Sbjct: 2547 RWRS 2550 >SB_43612| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 174 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 43 GHVCRMENGRIPKDLLYGELVHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 102 Query: 246 HWKS 257 W+S Sbjct: 103 RWRS 106 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 38.7 bits (86), Expect = 0.003 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E GR + L G R VGRP R+ D D++ W ++A DRS Sbjct: 676 GHVCRMEKGRIPKDFLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 735 Query: 246 HWKS 257 W+S Sbjct: 736 RWRS 739 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 37.9 bits (84), Expect = 0.006 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 176 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 235 Query: 246 HW 251 W Sbjct: 236 RW 237 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 37.9 bits (84), Expect = 0.006 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 176 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 235 Query: 246 HW 251 W Sbjct: 236 RW 237 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 37.9 bits (84), Expect = 0.006 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 396 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 455 Query: 246 HW 251 W Sbjct: 456 RW 457 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 37.9 bits (84), Expect = 0.006 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 6/62 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 228 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 287 Query: 246 HW 251 W Sbjct: 288 RW 289 >SB_23673| Best HMM Match : DUF855 (HMM E-Value=0.52) Length = 380 Score = 37.9 bits (84), Expect = 0.006 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 G++ R E+GR + +L G R VGRP R+ D D++ W ++A DRS Sbjct: 2 GYVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 61 Query: 246 HWKS 257 W+S Sbjct: 62 RWRS 65 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 37.5 bits (83), Expect = 0.007 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A D S Sbjct: 95 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDLS 154 Query: 246 HWKS 257 W+S Sbjct: 155 RWRS 158 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 37.5 bits (83), Expect = 0.007 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VG P R+ D D++ W ++A DRS Sbjct: 645 GHVCRMENGRIPKDLLYGELAHGSRPVGGPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRS 704 Query: 246 HWKS 257 W+S Sbjct: 705 RWRS 708 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 37.5 bits (83), Expect = 0.007 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRS 245 GH+ R E+GR + +L G R VGRP R+ D D++ W ++A D S Sbjct: 95 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDLS 154 Query: 246 HWKS 257 W+S Sbjct: 155 RWRS 158 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 37.5 bits (83), Expect = 0.007 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAGSRWMQ---VAMDRS 245 GH R+ R+ L W P+ GKR GRP W DL K G W Q +A +R Sbjct: 416 GHTLRKPATNITRQSLTWNPQ-GKRKRGRPRNTWRRDLDADAKQMGKTWGQLERLAQNRD 474 Query: 246 HWK 254 W+ Sbjct: 475 AWR 477 >SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 37.1 bits (82), Expect = 0.010 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGS------RWMQVAMDRS 245 GH+ R D R +++L G RS G R+ D L SA W ++A DR+ Sbjct: 298 GHVRRMSDTRIPKQLLYGELHYGTRSKGGQKKRYKDTLKVSAKQFGIDPDNWEELADDRT 357 Query: 246 HWKS 257 HW+S Sbjct: 358 HWRS 361 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 37.1 bits (82), Expect = 0.010 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGS------RWMQVAMDRS 245 GH+ R D R +++L G RS G R+ D L SA W ++A DR+ Sbjct: 230 GHVRRMSDTRIPKQLLYGELHYGTRSKGGQKKRYKDTLKVSAKQFGIDPDNWEELADDRT 289 Query: 246 HWKS 257 HW+S Sbjct: 290 HWRS 293 >SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) Length = 280 Score = 37.1 bits (82), Expect = 0.010 Identities = 26/78 (33%), Positives = 35/78 (44%), Gaps = 9/78 (11%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAGSRW---MQVAMDRS 245 GH+ R R + W P GKR GRP T W + + G W ++VA DR Sbjct: 204 GHVLRMGQERIPKTSALWTP-IGKRKPGRPKTTWRRTIQAELLEMGLTWGEALKVAKDRQ 262 Query: 246 HWK-SAKLIFP--KAGDN 290 W+ +FP + GDN Sbjct: 263 EWRHRVAALFPTREDGDN 280 >SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) Length = 254 Score = 37.1 bits (82), Expect = 0.010 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGS------RWMQVAMDRS 245 GH+ R D R +++L G RS G R+ D L SA W ++A DR+ Sbjct: 139 GHVRRMSDTRIPKQLLYGELHYGTRSKGGQKKRYKDTLKVSAKQFGIDPDNWEELADDRT 198 Query: 246 HWKS 257 HW+S Sbjct: 199 HWRS 202 >SB_49943| Best HMM Match : zf-nanos (HMM E-Value=9.2) Length = 153 Score = 36.3 bits (80), Expect = 0.017 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGS------RWMQVAMDRS 245 GH+ R D R +++L G RS G R+ D L SA W ++A DR+ Sbjct: 17 GHVRRMSDTRIPKQLLYGELHYGTRSKGGQKKRYKDTLKVSAKQFGIDPDNWEELADDRT 76 Query: 246 HWKS 257 HW S Sbjct: 77 HWSS 80 >SB_16378| Best HMM Match : DCX (HMM E-Value=0.7) Length = 754 Score = 36.3 bits (80), Expect = 0.017 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGS------RWMQVAMDRS 245 GH+ R D R +++L G RS G R+ D L SA W ++A DR+ Sbjct: 244 GHVRRMSDTRIPKQLLYGELHYGTRSKGGQKKRYKDTLKVSAKQFGIDPDNWEELADDRT 303 Query: 246 HWKS 257 HW S Sbjct: 304 HWSS 307 >SB_22340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 35.9 bits (79), Expect = 0.023 Identities = 21/74 (28%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWM------QVAMDRS 245 GH+ R + R + L W P G+R GRP T W ++ + +A DR Sbjct: 51 GHVLRMDQRRIPKVALRWTP-PGRRKPGRPKTTWRRTILSELSGHQLTLAEAQHMARDRR 109 Query: 246 HWKSAKLIFPKAGD 287 WK GD Sbjct: 110 KWKRFVAALCPTGD 123 >SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 35.5 bits (78), Expect = 0.030 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +DGR +++L G R VGRP R+ D L K Sbjct: 201 GHLCRMDDGRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 240 >SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 35.1 bits (77), Expect = 0.040 Identities = 41/152 (26%), Positives = 61/152 (40%), Gaps = 8/152 (5%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKS-------AGSRWMQVAMDR 242 GH+ R +D R +++L G R+VGRP R+ D L K + Q Sbjct: 201 GHLCRMDDDRVPKQLLFSELEQGSRAVGRPKLRFKDILKKDLKIGCVLEAWNYHQNQNGS 260 Query: 243 SHWKSAKLIFPKAGDN-APFWALRAKRGAVRDLFL*SSGSLTVTSQMVHSVNIVPSKALI 419 + K KA + WAL K +D + +T TS + V S + I Sbjct: 261 EELAACKSELEKAKEEIEKAWALYDKE---KDCLEKINWQMTETSDRLQDVTQESSSSSI 317 Query: 420 *SQSKSSEENRSLNHHAHPR*PIRGLTRDSQE 515 +SKS++E + N AH T+D E Sbjct: 318 --KSKSAQELETENRRAHSSWLSPSKTKDLME 347 >SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 202 Score = 35.1 bits (77), Expect = 0.040 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQ 227 GH+ R +D R +++L G R VGRP R+ D L K S WM+ Sbjct: 156 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDFLKKD--SNWMR 201 >SB_47792| Best HMM Match : RNA_pol_Rpb7_N (HMM E-Value=5.6) Length = 255 Score = 34.7 bits (76), Expect = 0.053 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKS------AGSRWMQVAMDRS 245 GH+ R + R R++L + TG R+ GRP R+ D + ++ + + W A DR Sbjct: 185 GHVHRMDTDRLPRQLLYSQLTTGTRNQGRPRLRFKDVVKRNLKWRDISSNSWQTTARDRP 244 Query: 246 HWK 254 W+ Sbjct: 245 AWR 247 >SB_19159| Best HMM Match : RVT_1 (HMM E-Value=0.00032) Length = 426 Score = 34.7 bits (76), Expect = 0.053 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKS------AGSRWMQVAMDRS 245 GH+ R + R R++L + TG R+ GRP R+ D + ++ + + W A DR Sbjct: 356 GHVHRMDTDRLPRQLLYSQLTTGTRNQGRPRLRFKDVVKRNLKWRDISSNSWQTTARDRP 415 Query: 246 HWK 254 W+ Sbjct: 416 AWR 418 >SB_13171| Best HMM Match : AT_hook (HMM E-Value=6.4) Length = 188 Score = 34.7 bits (76), Expect = 0.053 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKS------AGSRWMQVAMDRS 245 GH+ R + R R++L + TG R+ GRP R+ D + ++ + + W A DR Sbjct: 118 GHVHRMDTDRLPRQLLYSQLTTGTRNQGRPRLRFKDVVKRNLKWRDISSNSWQTTARDRP 177 Query: 246 HWK 254 W+ Sbjct: 178 AWR 180 >SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 869 Score = 34.7 bits (76), Expect = 0.053 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 ++GH+ R E+ R R++L +G R GRP R+ D+L Sbjct: 783 WYGHVIRMEESRIPRQVLYSELASGYRKKGRPKKRYKDNL 822 >SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 666 Score = 34.3 bits (75), Expect = 0.070 Identities = 23/75 (30%), Positives = 32/75 (42%), Gaps = 7/75 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAGSRW---MQVAMDRS 245 GH+ R R + W GKR +GRP T W + + G W ++VA DR Sbjct: 590 GHVLRMGQERIPKTSALWTS-IGKRKLGRPKTTWRRTIQAELLEMGLTWGKALKVAKDRQ 648 Query: 246 HWK-SAKLIFPKAGD 287 W+ +FP D Sbjct: 649 EWRHRVAALFPTRED 663 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 33.9 bits (74), Expect = 0.092 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQVAMDRSHWK 254 GH+ R E+GR + +L G R VGRP R+ D S + + +D +W+ Sbjct: 176 GHVCRMENGRIPKDLLYGELAHGSRPVGRPKLRFKD----SCKRDMLAIGLDVDNWE 228 >SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 629 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 + GH+ R E+ R R++L +G R GRP R+ D+L Sbjct: 504 WSGHVIRMEESRIPRQVLYSELASGYRKKGRPKKRYKDNL 543 >SB_10620| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 159 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 + GH+ R E+ R R++L +G R GRP R+ D+L Sbjct: 34 WSGHVIRMEESRIPRQVLYSELASGYRKKGRPKKRYKDNL 73 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 + GH+ R E+ R R++L +G R GRP R+ D+L Sbjct: 3274 WSGHVIRMEESRIPRQVLYSELASGYRKKGRPKKRYKDNL 3313 >SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) Length = 294 Score = 33.1 bits (72), Expect = 0.16 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R+VGRP R+ D L K Sbjct: 201 GHLCRMDDDRVPKQLLFSELEQGSRAVGRPKLRFKDILKK 240 >SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) Length = 744 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 651 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 690 >SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 387 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 294 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 333 >SB_16201| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 154 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 61 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 100 >SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 201 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 108 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 147 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 582 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 621 >SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 156 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 195 >SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 636 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 543 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 582 >SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 156 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 195 >SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQ 227 GH+ R +D R +++L G R VGRP R+ D K WM+ Sbjct: 156 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTFEKRP-QNWMR 202 >SB_11676| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 146 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 53 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 92 >SB_9839| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 127 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 34 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 73 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 32.7 bits (71), Expect = 0.21 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 162 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 201 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 32.3 bits (70), Expect = 0.28 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 + GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 746 WFGHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 787 >SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) Length = 1641 Score = 32.3 bits (70), Expect = 0.28 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAGSRWMQV 230 GH + R+ L W P+ GKR GRP W DL K G W Q+ Sbjct: 531 GHTLPKPATNITRQSLTWNPK-GKRKRGRPRNTWRRDLDADAKHMGKTWGQL 581 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 GH + R+ L W P+ GKR GRP W DL Sbjct: 171 GHTLPKPATNITRQSLTWNPK-GKRKRGRPRNTWRRDL 207 >SB_46411| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 146 Score = 32.3 bits (70), Expect = 0.28 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 5/63 (7%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAG-----SRWMQVAMDRSH 248 GH+ R +D R +++L G R VGRP R+ D L K W +R+ Sbjct: 53 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKKDLKIGCVLEAWNYHVHNRNE 112 Query: 249 WKS 257 W++ Sbjct: 113 WRA 115 >SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 32.3 bits (70), Expect = 0.28 Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAG-----SRWMQVAMDRSH 248 GH+ R +D R +++L G R VGRP R+ D L K W +R Sbjct: 156 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKKDVKIGCVLEAWNYHVHNRKE 215 Query: 249 WKS 257 W++ Sbjct: 216 WRA 218 >SB_21570| Best HMM Match : AT_hook (HMM E-Value=2) Length = 148 Score = 32.3 bits (70), Expect = 0.28 Identities = 19/51 (37%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +3 Query: 87 HIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAGSRWMQV 230 H R+ R+ L W P+ GKR GRP W DL K G W Q+ Sbjct: 90 HTLRKPATNITRQSLTWNPQ-GKRKRGRPRNTWRRDLDADAKHMGKTWGQL 139 >SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 392 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 313 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 352 >SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 404 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 311 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 350 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 981 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 1020 >SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 110 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDFLKK 149 >SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 342 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 381 >SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 963 Score = 31.9 bits (69), Expect = 0.37 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 + GH+ R E+ R R++ +G R GRP R+ D+L Sbjct: 838 WSGHVIRMEESRIPRQVFYSELASGYRKKGRPKKRYKDNL 877 >SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 110 GHLCRVDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 149 >SB_19708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 31.9 bits (69), Expect = 0.37 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+ R +D R +K+ +GKR G R+ D+L +KS + W A RS Sbjct: 1422 GHVVRMDDDRLPKKLFYSELSSGKRYTGGQYKRFKDNLKVNLKSFNIDVNSWETAAQKRS 1481 Query: 246 HWKS 257 W S Sbjct: 1482 TWLS 1485 >SB_13125| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 154 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 61 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 100 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 460 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 499 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 31.9 bits (69), Expect = 0.37 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 + GH+ R E+ R R++ +G R GRP R+ D+L Sbjct: 509 WSGHVIRMEESRIPRQVFYSELASGYRKKGRPKKRYKDNL 548 >SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 100 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 139 >SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 359 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 311 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 350 >SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 226 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 133 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 172 >SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 110 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 149 >SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 156 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 195 >SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) Length = 435 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 342 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 381 >SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) Length = 590 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 497 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 536 >SB_9256| Best HMM Match : PsiB (HMM E-Value=4.9) Length = 259 Score = 31.9 bits (69), Expect = 0.37 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 6/93 (6%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 50 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 109 Query: 246 HWKSAKLIFPKAGDNAPFWALRAKRGAVRDLFL 344 W+ + A A + A +R A R L L Sbjct: 110 GWRRV-ISDGAAACEANWTAAAEERRAARKLAL 141 >SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) Length = 404 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 311 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDILKK 350 >SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 31.9 bits (69), Expect = 0.37 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 + GH+ R E+ R R++ +G R GRP R+ D+L Sbjct: 676 WSGHVIRMEESRIPRQVFYRELASGYRKKGRPKKRYKDNL 715 >SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 235 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 188 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 227 >SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 31.9 bits (69), Expect = 0.37 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH R +D R +++L G R VGRP R+ D L K Sbjct: 110 GHFCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 149 >SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 31.5 bits (68), Expect = 0.49 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R VGRP R+ D L K Sbjct: 821 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPRLRFKDILKK 860 >SB_12469| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 127 Score = 31.5 bits (68), Expect = 0.49 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Frame = +3 Query: 102 EDGRWGRKILEWRPRTGKRSVGRPPTRWTD----DLIKSA--GSRWMQVAMDRSHWKS 257 E+GR + +L G R VGRP R+ D D++ W ++A DRS W+S Sbjct: 2 ENGRIPKDLLYGEFAHGSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRSRWRS 59 >SB_52811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 GH+ R +D R +++L G R VGRP R+ D L Sbjct: 61 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDIL 98 >SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 GH+ R +D R +++L G R VGRP R+ D L Sbjct: 149 GHLCRMDDDRVPKQLLFSELEHGSRPVGRPKLRFKDIL 186 >SB_59249| Best HMM Match : zf-C2H2 (HMM E-Value=0.016) Length = 236 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 114 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 173 Query: 246 HWK 254 W+ Sbjct: 174 GWR 176 >SB_54320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 124 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 183 Query: 246 HWK 254 W+ Sbjct: 184 GWR 186 >SB_52360| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 455 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 333 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 392 Query: 246 HWK 254 W+ Sbjct: 393 GWR 395 >SB_50181| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 503 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 381 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKTFNIDHTSWELLAQNRQ 440 Query: 246 HWK 254 W+ Sbjct: 441 GWR 443 >SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) Length = 1086 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 612 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 671 Query: 246 HWK 254 W+ Sbjct: 672 GWR 674 >SB_23032| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 855 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 733 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 792 Query: 246 HWK 254 W+ Sbjct: 793 GWR 795 >SB_14835| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 382 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 260 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 319 Query: 246 HWK 254 W+ Sbjct: 320 GWR 322 >SB_14424| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 272 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 150 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 209 Query: 246 HWK 254 W+ Sbjct: 210 GWR 212 >SB_10362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 234 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 293 Query: 246 HWK 254 W+ Sbjct: 294 GWR 296 >SB_263| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 272 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 150 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 209 Query: 246 HWK 254 W+ Sbjct: 210 GWR 212 >SB_58157| Best HMM Match : RVT_1 (HMM E-Value=1.6e-36) Length = 1092 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 970 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 1029 Query: 246 HWK 254 W+ Sbjct: 1030 GWR 1032 >SB_58057| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 576 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 465 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 524 Query: 246 HWK 254 W+ Sbjct: 525 GWR 527 >SB_47109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 238 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 297 Query: 246 HWK 254 W+ Sbjct: 298 GWR 300 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 GH+AR D R +K+L + GKR G R+ D L Sbjct: 150 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTL 187 >SB_35729| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 237 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 115 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 174 Query: 246 HWK 254 W+ Sbjct: 175 GWR 177 >SB_28415| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 356 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 234 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 293 Query: 246 HWK 254 W+ Sbjct: 294 GWR 296 >SB_26934| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 1443 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 1321 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 1380 Query: 246 HWK 254 W+ Sbjct: 1381 GWR 1383 >SB_19613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 469 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 528 Query: 246 HWK 254 W+ Sbjct: 529 GWR 531 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 875 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 934 Query: 246 HWK 254 W+ Sbjct: 935 GWR 937 >SB_2372| Best HMM Match : zf-C2H2 (HMM E-Value=0.0051) Length = 414 Score = 30.7 bits (66), Expect = 0.86 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 292 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 351 Query: 246 HWK 254 W+ Sbjct: 352 GWR 354 >SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 201 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 240 >SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) Length = 288 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 201 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 240 >SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 110 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 149 >SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 255 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 162 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 201 >SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 203 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 110 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 149 >SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 201 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 240 >SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 30.3 bits (65), Expect = 1.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R +D R +++L G R GRP R+ D L K Sbjct: 201 GHLCRMDDDRVPKQLLFSELEHGSRPAGRPKLRFKDILKK 240 >SB_10529| Best HMM Match : zf-C2H2 (HMM E-Value=0.0034) Length = 272 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 150 GHVARMPDERIPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 209 Query: 246 HWK 254 W+ Sbjct: 210 GWR 212 >SB_48322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +3 Query: 129 LEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQV------AMDRSHWK 254 L W P TG+R GRP T W ++ + + A DR WK Sbjct: 11 LRWTP-TGRRKPGRPKTTWRRTILSELSKHQLTLAEAQHKARDRRKWK 57 >SB_57293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1395 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 6/62 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+AR D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 1010 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 1069 Query: 246 HW 251 W Sbjct: 1070 GW 1071 >SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 6/59 (10%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAGSRW---MQVAMDR 242 GH+ R R + W P GKR GRP T W + + G W ++VA DR Sbjct: 51 GHVLRMGQERIPKTSALWTP-IGKRKPGRPKTTWRRTIQAELLEMGLTWGEALKVAKDR 108 >SB_18732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 1582 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTD 191 GH+ R + R R++L + TG R+ GRP R+ D Sbjct: 1546 GHVHRMDTDRLPRQLLYSQLTTGTRNQGRPRLRFKD 1581 >SB_6981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +3 Query: 129 LEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQV------AMDRSHWK 254 L W P TG+R GRP T W ++ + + A DR WK Sbjct: 11 LRWTP-TGRRKPGRPKTTWRRTILSELSKHQLTLAEAQHKARDRRKWK 57 >SB_7378| Best HMM Match : SCP (HMM E-Value=3.3e-29) Length = 264 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 171 PPTRWTDDLIKSAGSRWMQVAMDRSHWKSAKLIFPKAGDNAPFWALR 311 PP +W+D+L + A ++A RS S+K AG+N ++ R Sbjct: 136 PPLKWSDELAREAQYYAEKLAQQRSMQHSSKCSRNDAGENLAMFSGR 182 >SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2681 Score = 29.5 bits (63), Expect = 2.0 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -2 Query: 394 FTECTICDVTVRDPDDHKNRSLTAP---LLARSAQKGALSPALGKISLADFQCDR 239 ++E +ICDVT + R T+P L R K L PA+ + D QC R Sbjct: 292 WSEWSICDVTCGGGVQQRYRDCTSPSPSLGGRDCVKTGLGPAVVTRTCNDVQCPR 346 >SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIK 203 GH+ R + R +++L G R VGRP R+ D L K Sbjct: 156 GHLCRMDADRVPKQLLFSELEHGSRPVGRPKLRFKDTLKK 195 >SB_57774| Best HMM Match : GASA (HMM E-Value=7.6) Length = 105 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = -1 Query: 164 HTALASTWSPLQ---DLSAPSTVLSSCYVAMVRLHKKIFTQEYENEGKKETNK*ANN 3 HTALA++++P+Q DL P ++ S V M+ L Q KK+ + NN Sbjct: 15 HTALAASYAPVQFPVDLPGPYAMVLSLRVTMIMLLTTAVNQRTMLSIKKQVCQSKNN 71 >SB_26138| Best HMM Match : RhoGEF (HMM E-Value=0.0011) Length = 1199 Score = 29.1 bits (62), Expect = 2.6 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +3 Query: 168 RPPTRWTDDLIKSAGSRWMQVAMDRSHWK 254 RP + +D+++ + RW VA+ HW+ Sbjct: 840 RPKPQSWEDIVEKSSKRWSVVAVSAKHWQ 868 >SB_42604| Best HMM Match : DUF1196 (HMM E-Value=5) Length = 294 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 GH+AR D R +K+L + GKR G R+ D L Sbjct: 234 GHVARMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTL 271 >SB_9819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 28.7 bits (61), Expect = 3.5 Identities = 18/65 (27%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Frame = +3 Query: 111 RWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWM------QVAMDRSHWKSAKLIF 272 R + L W P G+R GRP T W ++ + +A DR WK Sbjct: 5 RISKVALRWTP-PGRRKPGRPKTTWRRTILSELSKHQLTLAEAQHMARDRRKWKRFVAAL 63 Query: 273 PKAGD 287 GD Sbjct: 64 CPTGD 68 >SB_24313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.3 bits (60), Expect = 4.6 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = -2 Query: 382 TICDVTVRDPDDHKNRSLTAPLLARSAQKGALSPALGKISLADFQCDRSIATCIQRDPAL 203 T DVT+RD + T S+ G LSP+ + F C RS++T +P + Sbjct: 49 TPTDVTMRDASSKSSLVTTQTSSIMSSTTGVLSPSNRD---SGFHCPRSVSTVAMVEPTV 105 >SB_20793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Frame = +3 Query: 129 LEWRPRTGKRSVGRPPTRWTDDLIKSAGS----RWMQV---AMDRSHWKS 257 L W P G+R GRP T W + + G W +V DR WK+ Sbjct: 194 LTWTPE-GRRKQGRPKTTWRRTVERERGEAGWRNWDEVRSKEADREKWKT 242 >SB_37327| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 168 Score = 28.3 bits (60), Expect = 4.6 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 6/42 (14%) Frame = +3 Query: 150 GKRSVGRPPTRWTDDLIK---SAG---SRWMQVAMDRSHWKS 257 G R VGRP R+ D + + G W ++A DRS W+S Sbjct: 5 GSRPVGRPKLRFKDSCKRDMLAIGLDVDNWEKLAEDRSRWRS 46 >SB_8491| Best HMM Match : LicD (HMM E-Value=0.0094) Length = 289 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 174 PTRWTDDLIKSAGSRWMQVAMDRSHWKSAKLIFP 275 P W + L KS G +MQV +++S K + FP Sbjct: 246 PNNWKEQLSKSYGKNFMQVPLEKS--KRVPVDFP 277 >SB_26581| Best HMM Match : SspP (HMM E-Value=2.7) Length = 135 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 97 RAMWPW*GYIKKYLLKNMKTKERKRQTNK 11 + + PW Y+ K K K KERK+Q NK Sbjct: 45 KKLTPWEAYLNK---KKEKKKERKKQKNK 70 >SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2) Length = 259 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRP 173 + GH+ R E+ R R++L +G R GRP Sbjct: 225 WSGHVIRMEESRIPRQVLYSELASGYRKKGRP 256 >SB_3857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 27.5 bits (58), Expect = 8.0 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 6/63 (9%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL---IKSAG---SRWMQVAMDRS 245 GH+A D R +K+L + GKR G R+ D L +K+ + W +A +R Sbjct: 50 GHVACMPDERLPKKLLFGELQHGKRCKGGQKKRFKDTLKLSLKAFNIDHTSWELLAQNRQ 109 Query: 246 HWK 254 W+ Sbjct: 110 GWR 112 >SB_50765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 27.5 bits (58), Expect = 8.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +3 Query: 84 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDL 197 GH+A D R +K+L + GKRS G R+ D L Sbjct: 287 GHVAPMSDERMPKKLLFGVLQHGKRSQGGQKKRFKDTL 324 >SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) Length = 1195 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 78 YHGHIARREDGRWGRKILEWRPRTGKRSVGRP 173 + GH+ R E+ R R++L +G R GRP Sbjct: 1044 WSGHVIRMEESRIPRQVLYSELASGYRKKGRP 1075 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,535,418 Number of Sequences: 59808 Number of extensions: 442326 Number of successful extensions: 1313 Number of sequences better than 10.0: 157 Number of HSP's better than 10.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -