BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a03f (531 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-28... 35 0.036 12_02_0520 - 19951590-19952174 30 1.0 10_05_0113 + 9280756-9283489,9283726-9284048,9284201-9284314 30 1.3 10_03_0031 + 7214010-7215450,7215534-7216913,7217007-7217386 29 2.3 01_06_0426 + 29270744-29271064 29 3.1 07_01_1201 - 11419851-11419913,11420090-11420311 28 4.1 04_01_0009 - 178579-178638,179151-179246,179504-179565,180181-18... 28 5.4 02_02_0317 + 8893593-8894207 28 5.4 11_08_0010 + 27605105-27607919,27607954-27608013,27608110-27608495 27 7.1 08_01_0998 - 10136050-10138356 27 7.1 02_01_0674 + 5020118-5020202,5020301-5020436,5021075-5021140,502... 27 7.1 10_08_0727 - 20133293-20135701 27 9.4 06_03_0843 + 25315089-25315417,25317274-25317310,25317439-253176... 27 9.4 02_04_0621 - 24502383-24502476,24502532-24504015,24504125-245041... 27 9.4 02_01_0677 - 5039344-5039793,5040415-5040462,5040540-5040776,504... 27 9.4 01_02_0019 + 10262685-10262909,10263014-10263076,10263155-102633... 27 9.4 >02_01_0041 + 279583-281622,281724-282047,282315-282443,282526-282648, 282768-282923,283224-283349,283426-283560,283815-283942, 284037-284148,284233-284547,284655-284771,284871-285166, 285252-285783,287980-288082,288808-288881,288965-289062, 289340-289380,289977-290032,290170-290244,290377-290469, 290602-290850,290930-291002,291681-291766,291853-291938, 292067-292142,292280-292347,292430-292496,292570-292665, 292741-292843,293214-293309,293396-293466 Length = 2047 Score = 35.1 bits (77), Expect = 0.036 Identities = 21/54 (38%), Positives = 27/54 (50%) Frame = +2 Query: 173 TECTICDVTVRDPDDHKNRSLTAPLLARSAQKGALSPALGKISLADFQCDRSIA 334 T+ D V D DD AP+ A+ + + AL PAL +SLAD D S A Sbjct: 11 TDADFFDKLVDDDDDLSPAPAPAPVPAQQSAEAALLPALSDLSLADDDTDPSPA 64 >12_02_0520 - 19951590-19952174 Length = 194 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 251 ARSAQKGALSPALGKISLADFQCDRSIATCIQRDPALFIRSSVHLVGGRPTLR-LPVRG 424 A +A KG + ++ + F CD+++A + A ++SSV G+P L+ +PV G Sbjct: 76 AAAAWKGGSNGGAAVVAWSVFSCDQAVAYALMAATAAALQSSVVGKRGQPELQWMPVCG 134 >10_05_0113 + 9280756-9283489,9283726-9284048,9284201-9284314 Length = 1056 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = -2 Query: 131 SLVRRTAL*IITLILDNLSEVLPETHKRSSVHLRKLILGGS 9 SL + L I L L+NLS +LP T S+ L+ + LGG+ Sbjct: 351 SLANCSNLIYINLQLNNLSGILPNTIANLSLELQSIRLGGN 391 >10_03_0031 + 7214010-7215450,7215534-7216913,7217007-7217386 Length = 1066 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 282 PLWERLV*QISSATGPLPPA 341 PL ERLV Q ++ TGP+PP+ Sbjct: 222 PLLERLVLQCNNLTGPVPPS 241 >01_06_0426 + 29270744-29271064 Length = 106 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 249 WPAAPKRGRYRPLWERLV*QISSATGPLPPASNETQR 359 W AP R R RP WE + S + G PPA +T R Sbjct: 62 WYEAP-RLRRRPPWEGATAKASVSKGRTPPAGEKTLR 97 >07_01_1201 - 11419851-11419913,11420090-11420311 Length = 94 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 344 GCRWQWTGRTGNLLN*SFPKRAITPPFGRCGPKGGR 237 G +W+ TG TG L SFP A+ P G P R Sbjct: 26 GQQWRSTGPTGKLCFCSFPAGALPPAAGAGQPAPDR 61 >04_01_0009 - 178579-178638,179151-179246,179504-179565,180181-180245, 181271-181363,181489-181592,182070-182153,182223-182303, 182829-182880,183048-183119,183411-183486,183568-183680, 184056-184203,184295-184372,184511-184640,184733-184923, 187039-187099,187201-187371 Length = 578 Score = 27.9 bits (59), Expect = 5.4 Identities = 22/59 (37%), Positives = 27/59 (45%) Frame = +1 Query: 223 EQVSYRPPFGPQRPKGGVIARFGKD*FSRFPVRPVHCHLHPTRPSAFY*VVGPSSRWPS 399 E+ Y P + PQ P+ GV+ G D R PV V LH P PS RWP+ Sbjct: 66 ERPMYLPEYPPQEPEQGVLL-LGDD---RDPVDRVEEALHCLPP------YDPSLRWPA 114 >02_02_0317 + 8893593-8894207 Length = 204 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = -1 Query: 480 GHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLI----KSAGSRW 343 G R GR+ WRP G+ + PT W D + + +GSRW Sbjct: 70 GEAGEESGSRCGRR---WRPGGGRDTDPHSPTSWRLDPVGEAGEESGSRW 116 >11_08_0010 + 27605105-27607919,27607954-27608013,27608110-27608495 Length = 1086 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 282 PLWERLV*QISSATGPLPPA 341 P+ + LV Q+++ TGP+PPA Sbjct: 223 PILQTLVLQVNNLTGPVPPA 242 >08_01_0998 - 10136050-10138356 Length = 768 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/61 (29%), Positives = 25/61 (40%) Frame = -1 Query: 438 ILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQVAMDRSHWKSAKLIFPKAGDNAPFWA 259 +L W+ + P T W+ SA S W V D + A+L P AG + A Sbjct: 44 LLRWKSTLSAAASASPLTTWSPATSSSACSSWRGVTCDAA-GHVAELSLPGAGLHGELRA 102 Query: 258 L 256 L Sbjct: 103 L 103 >02_01_0674 + 5020118-5020202,5020301-5020436,5021075-5021140, 5021219-5021290,5021362-5021433,5024242-5024301, 5024494-5024565,5024655-5024720,5024798-5024863, 5024945-5025273,5025713-5025969,5026213-5026484, 5026580-5026715,5026833-5026972,5027051-5027207, 5027476-5027634 Length = 714 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 237 PPPFWPAAPKRGRYRP 284 PPPF P P+R R RP Sbjct: 246 PPPFMPPPPRRPRNRP 261 >10_08_0727 - 20133293-20135701 Length = 802 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -2 Query: 137 NPSLVRRTAL*IITLILDNLSEVLPETHKRSSVHLRKLILGGS 9 +PSL R AL ++L + LS V+P + + L KL L G+ Sbjct: 97 SPSLARLPALESVSLFGNRLSGVIPASFVGLAATLHKLNLSGN 139 >06_03_0843 + 25315089-25315417,25317274-25317310,25317439-25317675, 25317745-25317792,25318144-25318577,25318675-25318759 Length = 389 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 386 VGGRPTLRLPVRGRHSRIFLPHRP--SSLRAMWP 481 VG PTL L R H R + H P S LR M+P Sbjct: 157 VGSGPTLDLASRLPHLRAVVLHSPILSGLRVMYP 190 >02_04_0621 - 24502383-24502476,24502532-24504015,24504125-24504177, 24504871-24504984,24505068-24505202,24505960-24506055, 24506692-24506827 Length = 703 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +3 Query: 402 HCACQYVVATPGSFCPIDRPLFVLC 476 HC+ P C D PLF LC Sbjct: 632 HCSFMLAEGNPNDLCTSDLPLFGLC 656 >02_01_0677 - 5039344-5039793,5040415-5040462,5040540-5040776, 5040862-5040898,5042474-5042491,5042801-5043153 Length = 380 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 386 VGGRPTLRLPVRGRHSRIFLPHRP--SSLRAMWP 481 VG PTL L R H R + H P S LR M+P Sbjct: 171 VGSGPTLDLASRLPHLRAVVLHSPILSGLRVMYP 204 >01_02_0019 + 10262685-10262909,10263014-10263076,10263155-10263316, 10263407-10263589,10263676-10263806,10264251-10264419, 10264524-10264653,10265702-10265898 Length = 419 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -3 Query: 448 GQKDPGVATTYWQAQCGTATY*MDRR 371 GQ+D VA Y QCG A Y +DRR Sbjct: 182 GQEDSHVALCYL-TQCGKARYIVDRR 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,185,081 Number of Sequences: 37544 Number of extensions: 405330 Number of successful extensions: 1114 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1078 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1178343540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -