BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a03f (531 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128835-1|BAC87635.1| 148|Homo sapiens protein ( Homo sapiens ... 31 2.5 BC041331-1|AAH41331.2| 1121|Homo sapiens ZNF335 protein protein. 31 3.3 >AK128835-1|BAC87635.1| 148|Homo sapiens protein ( Homo sapiens cDNA FLJ46332 fis, clone TESTI4045470. ). Length = 148 Score = 31.1 bits (67), Expect = 2.5 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 484 PWPHSTKRGRSMGQKDPGVATTYWQAQCGTATY*MDRRP-NKKRWVSLDAGGNGP 323 PWPH ++R R Q PG + CGT T+ RRP +K R G GP Sbjct: 22 PWPHRSQRCR---QAVPGHPAS---GCCGTGTFRTQRRPGDKSRRAGSRGRGAGP 70 >BC041331-1|AAH41331.2| 1121|Homo sapiens ZNF335 protein protein. Length = 1121 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = -1 Query: 468 RREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLIKSAGSRWMQVAMDRSHWKSAKLIFP 289 R + G W RK PR G PP RW ++A +R + +A RS ++A + P Sbjct: 14 RSQRGTWLRKPRSEVPRPYAPLSGSPPIRWRRTRWRAAATRPLGLAGPRSPLRAAWVWAP 73 Query: 288 KA 283 ++ Sbjct: 74 RS 75 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,869,230 Number of Sequences: 237096 Number of extensions: 2053857 Number of successful extensions: 4075 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4074 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5160237082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -