BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a02r (672 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 3.8 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 5.0 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 409 RERPNIRVMVLWRFFIKTMS 468 R PN+R++ LW ++T+S Sbjct: 227 RHLPNLRLLTLWHNKLRTLS 246 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -2 Query: 527 SLKQKKHEPLLIKTYNYIIPLIVLIKKRQRTITLILGR 414 S +Q + + + T +I+PL+VLI R ++ G+ Sbjct: 297 SPEQDDYYTIALLTTQFIVPLVVLIFTYTRIAIVVWGK 334 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 569,983 Number of Sequences: 2352 Number of extensions: 9844 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -