BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV12a02r (672 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06640.1 68416.m00772 protein kinase family protein contains ... 32 0.40 At3g06620.1 68416.m00769 protein kinase family protein contains ... 30 1.6 At3g06630.1 68416.m00770 protein kinase family protein contains ... 29 2.8 At5g49470.2 68418.m06121 protein kinase family protein contains ... 28 4.9 At5g49470.1 68418.m06122 protein kinase family protein contains ... 28 4.9 At1g67890.1 68414.m07752 protein kinase family protein contains ... 28 4.9 >At3g06640.1 68416.m00772 protein kinase family protein contains Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 763 Score = 31.9 bits (69), Expect = 0.40 Identities = 18/65 (27%), Positives = 35/65 (53%) Frame = +1 Query: 319 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNIRVMVLWRFFIKTMSGII*L*VLIN 498 SDV K +SKQ+ + +Q+F + ++M++ PN+ +L+ + G+ + + Sbjct: 468 SDVAVKLISKQEYSEEVIQSFRQEVSLMQRLRHPNV---LLFMGAVTLPQGLCIVSEFLP 524 Query: 499 RGSCF 513 RGS F Sbjct: 525 RGSLF 529 >At3g06620.1 68416.m00769 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 773 Score = 29.9 bits (64), Expect = 1.6 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +1 Query: 319 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNI 426 SDV K SKQ+ +A +++F + +M++ PN+ Sbjct: 516 SDVAVKVFSKQEYSAEVIESFKQEVLLMKRLRHPNV 551 >At3g06630.1 68416.m00770 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain, PF00989 PAS domain, and PF00785 PAC motif Length = 671 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/36 (30%), Positives = 23/36 (63%) Frame = +1 Query: 319 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNI 426 SDV K SKQ+ + + +++F + ++M++ PN+ Sbjct: 456 SDVAVKVFSKQEYSESVIKSFEKEVSLMKRLRHPNV 491 >At5g49470.2 68418.m06121 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 834 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 319 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNI 426 SDV K SKQ+ + + +F + ++M++ PN+ Sbjct: 513 SDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNV 548 >At5g49470.1 68418.m06122 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 483 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 319 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNI 426 SDV K SKQ+ + + +F + ++M++ PN+ Sbjct: 226 SDVAVKVFSKQEYSEEIITSFRQEVSLMKRLRHPNV 261 >At1g67890.1 68414.m07752 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 765 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 Query: 319 SDVTNKYLSKQQATANYLQAFNEHRNIMRQRERPNI 426 SDV K SKQ+ + + +F + ++M++ PN+ Sbjct: 509 SDVAVKVFSKQEYSEEIITSFKQEVSLMKRLRHPNV 544 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,450,322 Number of Sequences: 28952 Number of extensions: 190544 Number of successful extensions: 344 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 344 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -