BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p21r (567 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory pro... 27 0.15 AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical pro... 27 0.15 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.2 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 22 3.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.3 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 7.3 >DQ855498-1|ABH88185.1| 127|Tribolium castaneum chemosensory protein 12 protein. Length = 127 Score = 26.6 bits (56), Expect = 0.15 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 497 VLTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 VL VAV + A + T + + + + I SDRLL+++V Sbjct: 5 VLVLFVAVLSVVFAADKYTTKYDNIDLNQILKSDRLLKNYV 45 >AJ973445-1|CAJ01492.1| 127|Tribolium castaneum hypothetical protein protein. Length = 127 Score = 26.6 bits (56), Expect = 0.15 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 497 VLTAIVAVSTNEVADPRSTDRANALSIGSITSSDRLLRSFV 375 VL VAV + A + T + + + + I SDRLL+++V Sbjct: 5 VLVLFVAVVSVVFAADKYTTKYDNIDLNQILKSDRLLKNYV 45 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.0 bits (47), Expect = 1.8 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -3 Query: 121 VFVFLFAQKIRSPHFFN**FAYLLPKLPCLFFRTVNYC 8 VF+ FAQ + SP FN + Y +F R V C Sbjct: 141 VFILFFAQGLTSP-IFNLVYVYCCDNNFNVFLRQVFTC 177 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 120 FLFFCLHKKFVLPIFLINNSRIY 52 F FF ++ FVL +FL+ + Y Sbjct: 1270 FAFFMMNALFVLIVFLLTLKKDY 1292 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 120 FLFFCLHKKFVLPIFLINNSRIY 52 F FF ++ FVL +FL+ + Y Sbjct: 1270 FAFFMMNALFVLIVFLLTLKKDY 1292 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 213 CERAAKSIFFYRTNLGTLKCIFWTFTCKYTKF 118 C++ + F T LGT I+ CK +F Sbjct: 41 CDKISAICFLLSTILGTCWIIYVRIYCKEIRF 72 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.3 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 120 FLFFCLHKKFVLPIFL--INNSRIYYR 46 F FF + FVL +FL +N +I+ + Sbjct: 1270 FAFFMFNALFVLVVFLLQLNKDQIHVK 1296 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 7.3 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -1 Query: 120 FLFFCLHKKFVLPIFL--INNSRIYYR 46 F FF + FVL +FL +N +I+ + Sbjct: 1270 FAFFMFNALFVLVVFLLQLNKDQIHVK 1296 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 7.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 144 TFTCKYTKFLFFCLHKKFVLPI 79 +F Y +FL+ C H +L I Sbjct: 136 SFIENYCQFLYNCFHSTLLLMI 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,642 Number of Sequences: 336 Number of extensions: 2418 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -