BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p16r (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 25 0.56 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 25 0.56 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 25 0.56 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 24 1.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 4.0 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 4.0 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 4.0 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 4.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 7.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.0 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 7.0 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 9.2 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 25.4 bits (53), Expect = 0.56 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +3 Query: 363 SYH*LASNSFSRKYLIFCAKNASNPSAHR*NSESFGLKYRQLSNILVISPINSLNILYVC 542 S+H L SN+F Y K + ++ G+ ++N L SP+ S ++ YV Sbjct: 222 SFHRLTSNTFD--YDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVN 279 Query: 543 SFTFRST 563 + FR++ Sbjct: 280 TEQFRTS 286 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 25.4 bits (53), Expect = 0.56 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +3 Query: 363 SYH*LASNSFSRKYLIFCAKNASNPSAHR*NSESFGLKYRQLSNILVISPINSLNILYVC 542 S+H L SN+F Y K + ++ G+ ++N L SP+ S ++ YV Sbjct: 222 SFHRLTSNTFD--YDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVN 279 Query: 543 SFTFRST 563 + FR++ Sbjct: 280 TEQFRTS 286 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 25.4 bits (53), Expect = 0.56 Identities = 18/67 (26%), Positives = 32/67 (47%) Frame = +3 Query: 363 SYH*LASNSFSRKYLIFCAKNASNPSAHR*NSESFGLKYRQLSNILVISPINSLNILYVC 542 S+H L SN+F Y K + ++ G+ ++N L SP+ S ++ YV Sbjct: 222 SFHRLTSNTFD--YDPKFTKMTIDGESYTAQDGISGMALSPMTNNLYYSPVASTSLYYVN 279 Query: 543 SFTFRST 563 + FR++ Sbjct: 280 TEQFRTS 286 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 24.2 bits (50), Expect = 1.3 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +3 Query: 363 SYH*LASNSFSR--KYLIFCAKNASNPSAHR*NSESFGLKYRQLSNILVISPINSLNILY 536 S+H L SN+F KY+ S + FG+ ++N L SP++S ++ Y Sbjct: 223 SFHRLTSNTFDYDPKYIKMMDAGESFTA----QDGIFGMALSPMTNNLYYSPLSSRSLYY 278 Query: 537 V 539 V Sbjct: 279 V 279 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 649 SAWPFMEPVDPREAPTY 599 +A+ F P++PR PTY Sbjct: 379 NAYRFRPPLNPRFGPTY 395 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 649 SAWPFMEPVDPREAPTY 599 +A+ F P++PR PTY Sbjct: 390 NAYRFRPPLNPRFGPTY 406 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 649 SAWPFMEPVDPREAPTY 599 +A+ F P++PR PTY Sbjct: 390 NAYRFRPPLNPRFGPTY 406 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 649 SAWPFMEPVDPREAPTY 599 +A+ F P++PR PTY Sbjct: 379 NAYRFRPPLNPRFGPTY 395 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/31 (25%), Positives = 12/31 (38%) Frame = +2 Query: 494 YFSHITNKFT*HTICLFIHFSFHCLQIHWFF 586 Y + + + CL F C+ I W F Sbjct: 440 YVFQLLDSYAVSGFCLLFLMFFECIAISWAF 470 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/31 (25%), Positives = 12/31 (38%) Frame = +2 Query: 494 YFSHITNKFT*HTICLFIHFSFHCLQIHWFF 586 Y + + + CL F C+ I W F Sbjct: 493 YVFQLLDSYAVSGFCLLFLMFFECIAISWAF 523 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 465 FGLKYRQLSNILVISPINSLNILYV 539 FG+ ++N L SP+ S ++ YV Sbjct: 255 FGMALSPVTNNLYYSPLTSHSLYYV 279 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 83 HNNIYCHKNNK 115 HN+IYC K K Sbjct: 158 HNDIYCEKYEK 168 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,208 Number of Sequences: 438 Number of extensions: 3999 Number of successful extensions: 66 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -