BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p16f (574 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 25 1.7 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 7.1 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 25.0 bits (52), Expect = 1.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -1 Query: 511 NCTLSSTCTVKT*FCLQKHNHGNNAFQFIQSPTLSCSEAF 392 N +ST +V + HN+G+N +I P S E F Sbjct: 347 NIVEASTLSVNPQYYGDLHNNGHNILGYIHDPDNSFLEGF 386 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +3 Query: 456 CFCKQNYV 479 CFCK+NYV Sbjct: 72 CFCKKNYV 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,665 Number of Sequences: 2352 Number of extensions: 11322 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -