BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p15f (582 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0200 - 14179389-14180488,14180575-14180736,14180983-141813... 30 1.5 01_02_0116 - 11252220-11253313,11253398-11253559,11253977-112543... 30 1.5 02_04_0240 - 21194597-21194743,21195579-21195680,21195797-211958... 29 3.6 >08_02_0200 - 14179389-14180488,14180575-14180736,14180983-14181383, 14182078-14182272,14182980-14183094,14183180-14183428, 14184032-14184093,14184335-14184435,14184701-14184815, 14185211-14185302,14187619-14187777 Length = 916 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 362 LKGSGSW*EQYQRTVGTIDSRWV 294 +KG W +YQR GTID W+ Sbjct: 701 VKGLDEWPNEYQRQYGTIDLYWI 723 >01_02_0116 - 11252220-11253313,11253398-11253559,11253977-11254306, 11254328-11254377,11255195-11255389,11255532-11255625, 11255713-11255961,11256831-11256892,11257434-11257534, 11257766-11257880,11258384-11258475,11259197-11259333, 11259721-11259760 Length = 906 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 362 LKGSGSW*EQYQRTVGTIDSRWV 294 +KG W +YQR GTID W+ Sbjct: 693 VKGLDEWPNEYQRQYGTIDLYWI 715 >02_04_0240 - 21194597-21194743,21195579-21195680,21195797-21195875, 21195921-21196043,21196135-21196193,21196453-21196974, 21197434-21198177,21198426-21198506 Length = 618 Score = 28.7 bits (61), Expect = 3.6 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +3 Query: 261 SIPAWSKLKYSYPS*INGSNSALVLFSPTTTTFQLLPVSMENSTILHTVALSLDLPVAVS 440 S+P + K S+ S + SNS F + ++P S + ++ LHT +SL VS Sbjct: 400 SLPRAAVNKGSHVSHVALSNSTTQKFVTSHPKHSVMPNSSQRASTLHTTQVSLKRSAGVS 459 Query: 441 PV 446 V Sbjct: 460 SV 461 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,243,462 Number of Sequences: 37544 Number of extensions: 342159 Number of successful extensions: 800 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -