BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p10r (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7927| Best HMM Match : No HMM Matches (HMM E-Value=.) 132 2e-31 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 35 0.078 SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_36254| Best HMM Match : Filament (HMM E-Value=0.21) 32 0.42 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 32 0.42 SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) 31 0.73 SB_15799| Best HMM Match : PH (HMM E-Value=0.76) 31 0.73 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 31 0.73 SB_7681| Best HMM Match : Annexin (HMM E-Value=0) 31 0.96 SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 30 1.7 SB_43856| Best HMM Match : Laminin_I (HMM E-Value=0.057) 30 2.2 SB_37808| Best HMM Match : Avirulence (HMM E-Value=2.8) 29 2.9 SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) 29 3.9 SB_44491| Best HMM Match : Lipase_GDSL (HMM E-Value=4.5e-05) 29 5.1 SB_42866| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_23760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_45707| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_58132| Best HMM Match : DGPF (HMM E-Value=8.7) 28 6.8 SB_52774| Best HMM Match : rve (HMM E-Value=2e-17) 28 6.8 SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_40452| Best HMM Match : Upf2 (HMM E-Value=4.3) 28 6.8 SB_37386| Best HMM Match : DUF164 (HMM E-Value=0.46) 28 6.8 SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 6.8 SB_24914| Best HMM Match : Nuc_sug_transp (HMM E-Value=3.6e-15) 28 6.8 SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 28 6.8 SB_22261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_20593| Best HMM Match : RnaseH (HMM E-Value=1.9) 28 6.8 SB_17261| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 6.8 SB_15802| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 6.8 SB_9953| Best HMM Match : VWA (HMM E-Value=0) 28 6.8 SB_59670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) 28 6.8 SB_46683| Best HMM Match : F5_F8_type_C (HMM E-Value=9.6e-12) 28 6.8 SB_46069| Best HMM Match : NOPS (HMM E-Value=2) 28 6.8 SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17) 28 6.8 SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) 28 6.8 SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) 28 6.8 SB_23407| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 6.8 SB_22926| Best HMM Match : DGPF (HMM E-Value=8) 28 6.8 SB_21805| Best HMM Match : Upf2 (HMM E-Value=4) 28 6.8 SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) 28 6.8 SB_14016| Best HMM Match : rve (HMM E-Value=0.0027) 28 6.8 SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 28 6.8 SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21) 28 6.8 SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_619| Best HMM Match : rve (HMM E-Value=0.027) 28 6.8 SB_43687| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 28 9.0 SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19) 28 9.0 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) 28 9.0 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 28 9.0 >SB_7927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 555 Score = 132 bits (320), Expect = 2e-31 Identities = 88/250 (35%), Positives = 129/250 (51%), Gaps = 14/250 (5%) Frame = -3 Query: 710 NRKRKLERDIEVEXGDDYVLDLKKNYTEIPEDERYDVIPEIWEGHNIADYIDPDIFXXXX 531 ++ RKL D+E E G+DY LDL++ + ++E+ DVIPEI+ G NIADYIDPDI Sbjct: 308 SKTRKLAVDVERELGEDYYLDLRQQWDLKNKEEKGDVIPEIFLGKNIADYIDPDIMKKLE 367 Query: 530 XXXXXXXXXXAGGMY-AAPKIELDDTVREIRELARQIRNKKAILKDESRLVKQSTKPVMP 354 A G+Y + + ELD EI+ A +IR K+ ++ + R K + +P++P Sbjct: 368 ELEKEEELREAAGVYESESEEELDSEGEEIKNKAAEIREKRKLIVKQHRESKGTNRPIIP 427 Query: 353 RTSRAKTK----QRSTSKLRKDMEKLGVDMSE----TGDAHFTXXXXXXXXXXXXXXXXX 198 R + AK + +RS + D +K+ +D + TG Sbjct: 428 RKALAKAETARNKRSAGVIDSD-KKMDIDEDQDEPMTGRKRSRSQTPANAKRRRSNTASV 486 Query: 197 XXREPSNQP-----VADPIMRVKVKRMAHAAIAKKTKKMGLKGEADRFIGTKMPKHLFAG 33 R S P +++P + K K +A + +K +MG GEADR I TKMPKHLF+G Sbjct: 487 TPRSQSRVPRDQSGLSNPEKKQKAKTLA-KTVQRKMNRMGKAGEADRMIRTKMPKHLFSG 545 Query: 32 KRGVGKTDRR 3 KR GKT RR Sbjct: 546 KRKGGKTSRR 555 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 34.7 bits (76), Expect = 0.078 Identities = 19/66 (28%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Frame = -3 Query: 470 ELDDTVREIRELARQIRNKKAILKDESRLVK-QSTKPVMPRTSRAKTKQRSTSKLRKDME 294 EL+DT R++ +Q+ N+K K ES+ VK + P +PR++ A + +LR++++ Sbjct: 252 ELEDTKRQLSHQIQQLINEKNKRK-ESKFVKPKQQTPEVPRSTPAYERDDELERLRREVQ 310 Query: 293 KLGVDM 276 + +++ Sbjct: 311 RYRLEI 316 >SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 33.5 bits (73), Expect = 0.18 Identities = 17/56 (30%), Positives = 32/56 (57%) Frame = -3 Query: 470 ELDDTVREIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLRK 303 +LD VRE +EL R +R KAI D +++V+++T + + + + ++ L K Sbjct: 450 DLDHEVREKQELIRCMREVKAIEADMAQMVQENTSKFVDKLKKKELTEKEREGLLK 505 >SB_36254| Best HMM Match : Filament (HMM E-Value=0.21) Length = 589 Score = 32.3 bits (70), Expect = 0.42 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -3 Query: 452 REIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLRKDMEKLGVDMS 273 RE L R++RN + L D + KQS+ + T +T + S L D++K Sbjct: 314 REKNALQRELRNVREKLMDVENVHKQSSNALESATGEMQTARDKLSLLEFDLQKANKQKQ 373 Query: 272 ETGD 261 G+ Sbjct: 374 SVGE 377 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 32.3 bits (70), Expect = 0.42 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -3 Query: 452 REIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLRKDMEKLGVDMS 273 RE L R++RN + L D + KQS+ + T +T + S L D++K Sbjct: 2842 REKNALQRELRNVREKLMDVENVHKQSSNALESATGEMQTARDKLSLLEFDLQKANKQKQ 2901 Query: 272 ETGD 261 G+ Sbjct: 2902 SVGE 2905 >SB_17603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 31.9 bits (69), Expect = 0.55 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 Query: 477 QDRAGRHREGDQGTGPADTQQEGHSQGRVSPGEAVHEAG 361 Q R G +G++ GP+ Q +G+ +P AVH AG Sbjct: 464 QGRVGPKMDGNKHQGPSPLPQASADRGQTTPVNAVHPAG 502 >SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21) Length = 1329 Score = 31.5 bits (68), Expect = 0.73 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ RN K L E L+ +S + V+PR+ RA+ Sbjct: 915 QVDELAREYRNYKEELSVEDGLLFKSDRIVVPRSMRAE 952 >SB_15799| Best HMM Match : PH (HMM E-Value=0.76) Length = 836 Score = 31.5 bits (68), Expect = 0.73 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 665 DDYVLDLKKNYTEIPEDERYDVIPEIWEGHNIADYIDPDIF 543 DD D K E+ E+E D +PE+ +++Y D DIF Sbjct: 491 DDSSTDPVKENVEVEEEEFQDALPELSPPSRLSNYEDIDIF 531 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 31.5 bits (68), Expect = 0.73 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 665 DDYVLDLKKNYTEIPEDERYDVIPEIWEGHNIADYIDPDIF 543 DD D K E+ E+E D +PE+ +++Y D DIF Sbjct: 365 DDSSTDPVKENVEVEEEEFQDALPELSPPSRLSNYEDIDIF 405 >SB_7681| Best HMM Match : Annexin (HMM E-Value=0) Length = 426 Score = 31.1 bits (67), Expect = 0.96 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = -2 Query: 459 HREGDQGTGPADTQQEGHSQGRVSPGEAVHEAGDAAHLASQDQAEVHLQA---QEGHGET 289 H E ++G P E +G PG+ + E AH QD E A ++ H E Sbjct: 322 HEEEERGVHPPGEHHEEEERGAHPPGQDLEEEERGAHPPGQDHEEEERGAHPPEQHHEEE 381 Query: 288 WRG 280 RG Sbjct: 382 ERG 384 Score = 30.7 bits (66), Expect = 1.3 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 4/76 (5%) Frame = -2 Query: 495 RHVRRAQDRAGRHREGDQ-GTGPADTQQEGHSQGRVSPGEAVHEAGDAAHLASQDQAEVH 319 R + D G+H E ++ G P + E +G PGE E AH QD E Sbjct: 295 RERKEEADPPGQHHEEEERGVHPPEQHHEEEERGVHPPGEHHEEEERGAHPPGQDLEEEE 354 Query: 318 LQAQ---EGHGETWRG 280 A + H E RG Sbjct: 355 RGAHPPGQDHEEEERG 370 >SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/72 (20%), Positives = 33/72 (45%) Frame = -3 Query: 476 KIELDDTVREIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLRKDM 297 K ++D+T RE++E + ++ K +++ V ++ K V + S++ D+ Sbjct: 224 KTKVDETKREVQETKKDVQETKKEVQETKTKVDETNKEVQETKKEVHEVKGKVSEMAVDV 283 Query: 296 EKLGVDMSETGD 261 L + S D Sbjct: 284 ASLKEEFSTVQD 295 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -3 Query: 470 ELDDTVREIRELARQIRNKKAILKDESRLVK-QSTKPVMPRTSRAKTKQRSTSK 312 EL+DT R++ +Q+ N+K K ES+ VK + P +PR++ A Q +K Sbjct: 252 ELEDTKRQLSHQIQQLINEKNKRK-ESKFVKPKQQTPEVPRSTPAYEAQMKNAK 304 >SB_43856| Best HMM Match : Laminin_I (HMM E-Value=0.057) Length = 976 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = -3 Query: 473 IELDDTVREIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLRKDME 294 + L D +R + ++ N+K LKD +++++ + + R SR+ RS K ++E Sbjct: 112 VRLTDEIRGYADAEERLHNEKNDLKDAVGVLRKTLEGIERRLSRSGRSFRSLEKELTELE 171 Query: 293 KL 288 ++ Sbjct: 172 EV 173 >SB_37808| Best HMM Match : Avirulence (HMM E-Value=2.8) Length = 645 Score = 29.5 bits (63), Expect = 2.9 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = -2 Query: 459 HREGDQGTGPADTQQEGHSQGRVSP-----GEAVHEAGDAAHLASQDQAEVHLQAQ 307 HR+G+ G + GH QG V P + H G+ A LAS H Q + Sbjct: 173 HRQGNVGPLAIPSPNSGHRQGNVGPLAIPNPNSGHRQGNVAPLASPSPNSGHQQGK 228 Score = 27.9 bits (59), Expect = 9.0 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Frame = -2 Query: 459 HREGDQGTGPADTQQEGHSQGRVSP-----GEAVHEAGDAAHLASQDQAEVHLQAQEG 301 HR+G+ + + GH QG V+P + H G+ A LA H Q G Sbjct: 122 HRQGNVAQLALPSPKSGHRQGNVAPLALPSPNSGHRQGNVAQLALPSPKSGHRQGNVG 179 Score = 27.9 bits (59), Expect = 9.0 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Frame = -2 Query: 459 HREGDQGTGPADTQQEGHSQGRVS----PG-EAVHEAGDAAHLASQDQAEVHLQAQ 307 HR+G+ + + GH QG+VS P + H G+ A LAS H Q + Sbjct: 207 HRQGNVAPLASPSPNSGHQQGKVSQLALPSPNSGHRQGNVAPLASPSPNSGHQQGK 262 >SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) Length = 765 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = -3 Query: 470 ELDDTVREIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKL 309 E DT++++ + Q +A+LK+ ++V KP P A + S+SKL Sbjct: 307 ERSDTLQKLEKEVLQNGKLQAVLKELQQIVNTPIKPFTPSPGVATSGSVSSSKL 360 >SB_44491| Best HMM Match : Lipase_GDSL (HMM E-Value=4.5e-05) Length = 720 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 404 LKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLRKDMEKLGVDMS 273 LK +KQ+ K + +RA+ K TSK K + K +D+S Sbjct: 227 LKGVLEKIKQARKASKKKRARARKKHNKTSKKSKHVSKKPLDIS 270 >SB_42866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 28.7 bits (61), Expect = 5.1 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = -2 Query: 171 GGRPHHARESKEDGARGHRQEDQEDGPQGRGGPVHRHQDAEASVR 37 GGR +E DG RG ++E EDG GRG D E R Sbjct: 270 GGRGDK-KEHMADGGRGDKKEHMEDG--GRGDKKEHMADGERGDR 311 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -3 Query: 470 ELDDTVREIRELARQIRNKKAILKDESRLVKQ--STKPVMPRTSRAKTKQRSTSKLRKDM 297 +LD+ +++++ A+ NK+ KDES K+ +TK + +AK + S S + + Sbjct: 232 DLDEDLKDVQTPAKSAPNKEDKSKDESTEEKEESATKAEVDDNKKAKADKASISIISDEK 291 Query: 296 EK 291 E+ Sbjct: 292 EE 293 >SB_23760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/49 (28%), Positives = 28/49 (57%) Frame = -3 Query: 452 REIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTKQRSTSKLR 306 R++R +RQ+R K ++ ESR V+ ++ V + + + + R + LR Sbjct: 468 RQVRVESRQVRVKSRQVRVESRQVRVKSRQVRVESRQVRVESRLSRHLR 516 >SB_45707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -3 Query: 443 RELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAKTK 330 ++ ARQ R K + +D+ + KQ+ +P R + KTK Sbjct: 405 KKAARQARRKTSTPQDQDKQDKQAARPRQARQASRKTK 442 >SB_58132| Best HMM Match : DGPF (HMM E-Value=8.7) Length = 161 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_52774| Best HMM Match : rve (HMM E-Value=2e-17) Length = 329 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 363 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 400 >SB_40452| Best HMM Match : Upf2 (HMM E-Value=4.3) Length = 245 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_37386| Best HMM Match : DUF164 (HMM E-Value=0.46) Length = 189 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = -3 Query: 494 GMYAAPKIELDDTVREIRELARQIRNKKA---ILKDESRLVKQSTKPVMPRTSRAKTKQR 324 G+Y A + EL+D +++ +++++ KA + +E+ +K + + R S + Q Sbjct: 49 GIYKAQQDELEDAEKQLASTRKKLQDMKASYEAVNEENEKLKNDLESIKRRISEMEGVQE 108 Query: 323 STSKLRKD 300 S + + D Sbjct: 109 SVTVVEVD 116 >SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 1183 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 769 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 806 >SB_24914| Best HMM Match : Nuc_sug_transp (HMM E-Value=3.6e-15) Length = 979 Score = 28.3 bits (60), Expect = 6.8 Identities = 31/123 (25%), Positives = 42/123 (34%), Gaps = 2/123 (1%) Frame = -2 Query: 405 SQGRVSPGEAVHEAGDAAHLASQDQAEVHLQAQEGHGETWRGHVGDXXXXXXXXXXXXXX 226 S+ + GEA EAG+A+ + +A +A E GE V Sbjct: 688 SEASEAAGEATGEAGEASEASEAGEASEAGEAGEA-GEASEAGVAGEAVEGSEASKAGEA 746 Query: 225 XXXXXXXXXXXAGTLQPAG--GRPHHARESKEDGARGHRQEDQEDGPQGRGGPVHRHQDA 52 AG AG G+ A E+ E G E E+G G +D Sbjct: 747 GEAVEAGEASEAGEASEAGEAGKAGEASEAGEASEVGEASEAGENGVASEAG-----EDG 801 Query: 51 EAS 43 EAS Sbjct: 802 EAS 804 >SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1197 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 783 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 820 >SB_22261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 14 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 51 >SB_20593| Best HMM Match : RnaseH (HMM E-Value=1.9) Length = 341 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 304 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 341 >SB_17261| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 356 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_15802| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 481 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_9953| Best HMM Match : VWA (HMM E-Value=0) Length = 1034 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 806 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 843 >SB_59670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 590 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 627 >SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21) Length = 1336 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 867 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 904 >SB_46683| Best HMM Match : F5_F8_type_C (HMM E-Value=9.6e-12) Length = 495 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/50 (36%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -2 Query: 180 QPAGGRPHHARESKEDGARGHRQEDQEDG--PQGRGGPVHRHQDAEASVR 37 Q AGG ARE ++ G G R + +G P R G H EA R Sbjct: 264 QDAGGTRARAREEQDTGRGGGRATETTEGTAPHVREGEDEVHTAGEAGFR 313 >SB_46069| Best HMM Match : NOPS (HMM E-Value=2) Length = 278 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_45481| Best HMM Match : rve (HMM E-Value=3.1e-17) Length = 414 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 14 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 51 >SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 1034 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 488 TCRQPRAVPRPSPTLPVYQRCPGRYS 565 TC QP A P+P+P P RYS Sbjct: 488 TCTQPSAKPKPAPRPPSVSLARRRYS 513 >SB_31903| Best HMM Match : Amino_oxidase (HMM E-Value=3.36312e-44) Length = 1021 Score = 28.3 bits (60), Expect = 6.8 Identities = 35/164 (21%), Positives = 57/164 (34%), Gaps = 14/164 (8%) Frame = -2 Query: 459 HREGDQGTGPADTQQEGHSQGRVSPGEAV--HEAGDAAHLASQDQAEVHLQAQEGHGETW 286 H +GD G + GH +G + G+ HE GD H ++ H + HG+ Sbjct: 291 HEKGDMQHGKKNM---GHEEGDMQHGKKNMGHERGDMQH-GKKNMG--HEKGDMQHGKKN 344 Query: 285 RGHV-GDXXXXXXXXXXXXXXXXXXXXXXXXXAGTLQPAGGRPHHARESKEDGAR--GHR 115 GH GD G +Q H + + G + GH Sbjct: 345 MGHEKGDMQHGKKNMEHEEGDMQHGKKNMGHEEGDMQQGKKSMEHEKGDMQHGKKNMGHE 404 Query: 114 QEDQEDGPQGRG---GPVHR------HQDAEASVRWKTWGRQDG 10 + D + G + G G + H++ + R K G ++G Sbjct: 405 EGDMQHGKKNMGHEEGDMQHGKKNMEHEEGDMQHRKKNMGHEEG 448 >SB_23407| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 327 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 14 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 51 >SB_22926| Best HMM Match : DGPF (HMM E-Value=8) Length = 203 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 14 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 51 >SB_21805| Best HMM Match : Upf2 (HMM E-Value=4) Length = 227 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_18588| Best HMM Match : zf-C2H2 (HMM E-Value=0.0061) Length = 503 Score = 28.3 bits (60), Expect = 6.8 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 7/74 (9%) Frame = -3 Query: 470 ELDDTVREIRELARQIRNKKAILKDE---SRLVKQSTKPVMPRTSRAKTKQRST----SK 312 EL+D +EI L +++ + A LK+E S +K + + + + +Q+ + Sbjct: 111 ELEDKTQEILNLQQELNDVNASLKEERWYSTALKDEVEKLNNQNKALQDQQKQVEQEKEQ 170 Query: 311 LRKDMEKLGVDMSE 270 +RKD EK ++ E Sbjct: 171 MRKDFEKRLIEEKE 184 >SB_14016| Best HMM Match : rve (HMM E-Value=0.0027) Length = 430 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019) Length = 1234 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 538 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 575 >SB_12115| Best HMM Match : rve (HMM E-Value=6.9e-21) Length = 428 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 14 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 51 >SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 502 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 539 >SB_619| Best HMM Match : rve (HMM E-Value=0.027) Length = 290 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 ++ ELAR+ N K L E L+ +S + V+PR+ RA+ Sbjct: 89 QVDELAREYWNYKEELSVEDGLLFKSDRIVVPRSMRAE 126 >SB_43687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 102 EDGPQGRGGPVHRHQDAEASVRWKTWGRQDG 10 ED GG HR +D EAS+ K +DG Sbjct: 417 EDDDDVNGGDYHRVEDDEASITIKQTNAEDG 447 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 132 GARGHRQEDQEDGPQGRGGP 73 GA+G R +D +DG QG GP Sbjct: 837 GAKGARGDDGKDGKQGPAGP 856 >SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19) Length = 1451 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -3 Query: 449 EIRELARQIRNKKAILKDESRLVKQSTKPVMPRTSRAK 336 +I ELAR+ N + L E L+ +S + V+PR RAK Sbjct: 847 QIDELAREYFNYREELSVEDGLLFKSDRIVVPRGMRAK 884 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = -2 Query: 180 QPAGGRPHHARESKEDGARGHRQEDQ--EDG 94 +PA GRP H++E KE R+ D+ EDG Sbjct: 189 RPAHGRPGHSKERKEGEKDKGRKSDEKSEDG 219 >SB_24828| Best HMM Match : Peptidase_A17 (HMM E-Value=1.7e-23) Length = 1531 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -3 Query: 716 KENRKRKLERDIEVEXGDDYVLDLKKNYTEIPE 618 K+ KR + +IE++ D Y L+ NYTE PE Sbjct: 317 KDGNKRWVCSNIELDMPDTYKLETNSNYTE-PE 348 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 27.9 bits (59), Expect = 9.0 Identities = 22/50 (44%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 441 PDLPHGVVQLDLGRGVHAASLAQFLVLLQLCQFIKD-VR-VDIVGDVVSL 584 PDL H V D GRGVH+ L L ++ C F VR +D+V VSL Sbjct: 24 PDLHH-VTSKDCGRGVHSDGLETPLT-IKNCVFAGSMVRGIDVVSGHVSL 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,342,793 Number of Sequences: 59808 Number of extensions: 325553 Number of successful extensions: 1731 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 1486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1700 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -