BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11p09r (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 7.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 7.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 7.0 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 365 RIENFRVVSPTVERWVQSNNVRN 433 RI F ++ VE WV ++ +RN Sbjct: 261 RILYFHSLASRVESWVNTSVIRN 283 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 418 ALDPSLHGWTHNPEI 374 AL +LH W H PEI Sbjct: 465 ALCNTLHHWHHCPEI 479 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 7.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 473 STETKSDNANKLGIVAEGCSQDIDEFSN*ST 565 STET + N L CSQ +SN T Sbjct: 347 STETLNTKCNTLERTPSKCSQTSVHYSNGQT 377 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,371 Number of Sequences: 438 Number of extensions: 4524 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -